Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8L205

Protein Details
Accession A0A4S8L205    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
299-320GVRIKRLVTRDRRRSRYPLIKLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 6, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039731  Rce1  
IPR003675  Rce1-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0004222  F:metalloendopeptidase activity  
GO:0071586  P:CAAX-box protein processing  
Pfam View protein in Pfam  
PF02517  Rce1-like  
Amino Acid Sequences MSTAVLSVTEAYFLSLAFTLVYVGSLYIFKCAQVARIVTTLSSCNNSRKTWSGRKKTEYELGMDEMRRLLQEEERQKKNGKGVPPPHKLSRNQFDRNDSRTVLTRLLCISLASILSFAILWRVVYVRVYERGYSQPGEIYRLTNYDWDNTSPLVSFKFARRLLGLRVGSLGVLKSLTYLLLPFVLVYALFRSLTRNRSNATPHSTYGIVLVLLRDFLVGPMTEEIVFRGCITAVFRLTKVQRVNPWSPYIRRSFTYTKFAQLDIETNPASDPLDSMILAHIVFISSFLYTIAHLHHGIGVRIKRLVTRDRRRSRYPLIKLTTIAVLQIGLGCLYTSIFVSHLSTPSIFSAILAHVFVNIAFHVTRDIGFEVSTIDKWINGHQDKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.06
10 0.05
11 0.06
12 0.08
13 0.08
14 0.11
15 0.11
16 0.1
17 0.13
18 0.14
19 0.16
20 0.19
21 0.21
22 0.21
23 0.22
24 0.23
25 0.2
26 0.22
27 0.21
28 0.18
29 0.21
30 0.21
31 0.27
32 0.32
33 0.33
34 0.36
35 0.42
36 0.49
37 0.56
38 0.64
39 0.67
40 0.72
41 0.78
42 0.78
43 0.76
44 0.75
45 0.66
46 0.59
47 0.51
48 0.45
49 0.41
50 0.36
51 0.31
52 0.24
53 0.22
54 0.18
55 0.17
56 0.15
57 0.17
58 0.25
59 0.35
60 0.43
61 0.47
62 0.51
63 0.54
64 0.56
65 0.58
66 0.56
67 0.52
68 0.54
69 0.59
70 0.66
71 0.7
72 0.71
73 0.71
74 0.72
75 0.72
76 0.71
77 0.72
78 0.7
79 0.71
80 0.69
81 0.7
82 0.7
83 0.68
84 0.62
85 0.53
86 0.46
87 0.42
88 0.4
89 0.36
90 0.29
91 0.27
92 0.23
93 0.23
94 0.21
95 0.16
96 0.14
97 0.1
98 0.1
99 0.08
100 0.07
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.07
112 0.09
113 0.11
114 0.15
115 0.16
116 0.16
117 0.18
118 0.21
119 0.23
120 0.22
121 0.2
122 0.19
123 0.18
124 0.21
125 0.2
126 0.18
127 0.16
128 0.16
129 0.17
130 0.17
131 0.17
132 0.16
133 0.17
134 0.17
135 0.17
136 0.16
137 0.16
138 0.12
139 0.12
140 0.11
141 0.11
142 0.11
143 0.12
144 0.2
145 0.2
146 0.21
147 0.22
148 0.24
149 0.25
150 0.31
151 0.28
152 0.2
153 0.2
154 0.19
155 0.17
156 0.15
157 0.13
158 0.05
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.03
173 0.03
174 0.04
175 0.04
176 0.05
177 0.05
178 0.09
179 0.12
180 0.19
181 0.21
182 0.23
183 0.23
184 0.27
185 0.31
186 0.32
187 0.35
188 0.31
189 0.29
190 0.29
191 0.28
192 0.24
193 0.21
194 0.16
195 0.1
196 0.07
197 0.07
198 0.05
199 0.05
200 0.04
201 0.04
202 0.03
203 0.03
204 0.04
205 0.04
206 0.05
207 0.05
208 0.06
209 0.06
210 0.06
211 0.07
212 0.07
213 0.07
214 0.06
215 0.06
216 0.05
217 0.06
218 0.07
219 0.09
220 0.1
221 0.11
222 0.12
223 0.17
224 0.18
225 0.24
226 0.25
227 0.27
228 0.31
229 0.37
230 0.41
231 0.39
232 0.43
233 0.43
234 0.42
235 0.43
236 0.43
237 0.38
238 0.36
239 0.39
240 0.41
241 0.4
242 0.45
243 0.41
244 0.42
245 0.4
246 0.39
247 0.34
248 0.28
249 0.26
250 0.2
251 0.23
252 0.16
253 0.15
254 0.15
255 0.13
256 0.12
257 0.1
258 0.09
259 0.06
260 0.07
261 0.07
262 0.07
263 0.07
264 0.07
265 0.07
266 0.07
267 0.05
268 0.04
269 0.04
270 0.05
271 0.05
272 0.04
273 0.04
274 0.05
275 0.05
276 0.05
277 0.06
278 0.08
279 0.1
280 0.1
281 0.1
282 0.13
283 0.14
284 0.15
285 0.2
286 0.2
287 0.2
288 0.22
289 0.22
290 0.23
291 0.27
292 0.36
293 0.41
294 0.5
295 0.59
296 0.68
297 0.75
298 0.79
299 0.82
300 0.82
301 0.82
302 0.8
303 0.79
304 0.74
305 0.69
306 0.63
307 0.56
308 0.48
309 0.37
310 0.29
311 0.19
312 0.13
313 0.1
314 0.1
315 0.08
316 0.05
317 0.05
318 0.05
319 0.05
320 0.05
321 0.05
322 0.05
323 0.06
324 0.06
325 0.07
326 0.1
327 0.12
328 0.14
329 0.15
330 0.15
331 0.16
332 0.17
333 0.17
334 0.14
335 0.12
336 0.13
337 0.12
338 0.13
339 0.12
340 0.11
341 0.1
342 0.1
343 0.1
344 0.09
345 0.07
346 0.09
347 0.08
348 0.08
349 0.1
350 0.11
351 0.11
352 0.13
353 0.15
354 0.13
355 0.13
356 0.13
357 0.13
358 0.15
359 0.15
360 0.14
361 0.13
362 0.14
363 0.15
364 0.2
365 0.28
366 0.33