Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MM17

Protein Details
Accession A0A4S8MM17    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
45-68RCRECGHRIMYKKRTKRMVQFEARHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, cyto 7, cyto_pero 4.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR006591  RNAP_P/RPABC4  
IPR039747  RPABC4  
IPR029040  RPABC4/Spt4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF03604  DNA_RNApol_7kD  
Amino Acid Sequences MNDQQSNPSGMSGGNPLLQPQRQEMEYLCADCGAKNEIKSREPIRCRECGHRIMYKKRTKRMVQFEAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.18
5 0.19
6 0.19
7 0.2
8 0.21
9 0.19
10 0.21
11 0.19
12 0.2
13 0.19
14 0.19
15 0.16
16 0.13
17 0.13
18 0.12
19 0.12
20 0.1
21 0.1
22 0.11
23 0.17
24 0.19
25 0.21
26 0.25
27 0.28
28 0.35
29 0.38
30 0.45
31 0.44
32 0.48
33 0.5
34 0.54
35 0.56
36 0.54
37 0.55
38 0.55
39 0.59
40 0.63
41 0.69
42 0.71
43 0.73
44 0.76
45 0.8
46 0.81
47 0.83
48 0.83