Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8M4B7

Protein Details
Accession A0A4S8M4B7    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
111-130DACFRLKRKRVSTWSRDPSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 9.833, nucl 7.5, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR041457  CxC2_KDZ-assoc  
Pfam View protein in Pfam  
PF18803  CxC2  
Amino Acid Sequences MRCRWFPATHTHPRTTFMFQFLEQFHIMNLSGKINLYDYYKAIEKLTDNTGGKIPNRYPSSLRVRSIEETKPAELAVKCIACPDPDVNLPTNWTEAPAEMKFLYILFLAFDACFRLKRKRVSTWSRDPSLQDGWAYFVENKPYLALV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.54
3 0.48
4 0.41
5 0.37
6 0.31
7 0.35
8 0.32
9 0.32
10 0.25
11 0.22
12 0.18
13 0.17
14 0.17
15 0.15
16 0.15
17 0.12
18 0.12
19 0.12
20 0.13
21 0.12
22 0.13
23 0.14
24 0.14
25 0.13
26 0.15
27 0.17
28 0.17
29 0.17
30 0.17
31 0.15
32 0.17
33 0.19
34 0.23
35 0.21
36 0.22
37 0.24
38 0.24
39 0.24
40 0.26
41 0.25
42 0.26
43 0.28
44 0.29
45 0.28
46 0.33
47 0.42
48 0.42
49 0.42
50 0.36
51 0.37
52 0.38
53 0.41
54 0.35
55 0.3
56 0.27
57 0.25
58 0.23
59 0.2
60 0.21
61 0.16
62 0.16
63 0.14
64 0.12
65 0.12
66 0.13
67 0.13
68 0.1
69 0.12
70 0.11
71 0.11
72 0.12
73 0.14
74 0.15
75 0.14
76 0.15
77 0.14
78 0.15
79 0.12
80 0.12
81 0.1
82 0.09
83 0.13
84 0.12
85 0.13
86 0.12
87 0.12
88 0.11
89 0.11
90 0.11
91 0.07
92 0.07
93 0.05
94 0.05
95 0.06
96 0.05
97 0.06
98 0.07
99 0.08
100 0.12
101 0.15
102 0.25
103 0.31
104 0.41
105 0.48
106 0.56
107 0.65
108 0.72
109 0.78
110 0.79
111 0.81
112 0.76
113 0.72
114 0.64
115 0.59
116 0.52
117 0.45
118 0.35
119 0.27
120 0.25
121 0.23
122 0.23
123 0.2
124 0.19
125 0.23
126 0.23
127 0.23