Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LPH7

Protein Details
Accession A0A4S8LPH7   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
78-107IRKSRAERSDKGKKHKVRKNPAAAKPPPKKBasic
NLS Segment(s)
PositionSequence
78-107IRKSRAERSDKGKKHKVRKNPAAAKPPPKK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MEYTNFEVDIVAAEGVHIVGWPEHIPFKSPSAMTTSQHINDIYNSWHEGKAHWARLTPVELNKLNRRLQNDEEAGIPIRKSRAERSDKGKKHKVRKNPAAAKPPPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.11
11 0.11
12 0.14
13 0.16
14 0.18
15 0.21
16 0.2
17 0.2
18 0.23
19 0.26
20 0.24
21 0.25
22 0.26
23 0.23
24 0.25
25 0.24
26 0.18
27 0.16
28 0.16
29 0.14
30 0.12
31 0.13
32 0.13
33 0.13
34 0.13
35 0.12
36 0.19
37 0.23
38 0.25
39 0.24
40 0.23
41 0.23
42 0.24
43 0.27
44 0.21
45 0.18
46 0.2
47 0.22
48 0.26
49 0.31
50 0.35
51 0.37
52 0.38
53 0.4
54 0.4
55 0.41
56 0.43
57 0.39
58 0.34
59 0.3
60 0.29
61 0.26
62 0.22
63 0.19
64 0.13
65 0.14
66 0.16
67 0.18
68 0.24
69 0.33
70 0.4
71 0.47
72 0.54
73 0.64
74 0.69
75 0.76
76 0.78
77 0.78
78 0.8
79 0.83
80 0.84
81 0.85
82 0.87
83 0.89
84 0.89
85 0.89
86 0.88
87 0.89