Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MRC3

Protein Details
Accession A0A4S8MRC3   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-46AVKIPIVKKRTKHFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-49KKRTKHFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQTP
Subcellular Location(s) nucl 15, mito_nucl 13.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIPIVKKRTKHFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQTPMPKIGYGSNKRTRHLLPNGLKKFLVSNVRELDLLLMHNKSYAAEIAHNVSSRNRITILERAKVLGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.89
4 0.92
5 0.91
6 0.9
7 0.88
8 0.86
9 0.83
10 0.76
11 0.66
12 0.62
13 0.6
14 0.59
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.83
28 0.76
29 0.74
30 0.71
31 0.69
32 0.69
33 0.66
34 0.67
35 0.68
36 0.71
37 0.64
38 0.58
39 0.51
40 0.45
41 0.46
42 0.4
43 0.41
44 0.45
45 0.46
46 0.46
47 0.49
48 0.46
49 0.45
50 0.45
51 0.46
52 0.43
53 0.52
54 0.53
55 0.51
56 0.48
57 0.4
58 0.36
59 0.31
60 0.31
61 0.22
62 0.25
63 0.25
64 0.26
65 0.25
66 0.24
67 0.2
68 0.13
69 0.13
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.08
79 0.09
80 0.1
81 0.13
82 0.14
83 0.15
84 0.15
85 0.15
86 0.2
87 0.19
88 0.2
89 0.18
90 0.18
91 0.21
92 0.29
93 0.33
94 0.32
95 0.32
96 0.31
97 0.32
98 0.31
99 0.28
100 0.25
101 0.2
102 0.18
103 0.22
104 0.26
105 0.27
106 0.27
107 0.31
108 0.28