Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MM96

Protein Details
Accession G9MM96    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-118GDGKVTKKPKARTPKKAVAKKEESEBasic
NLS Segment(s)
PositionSequence
96-114GKVTKKPKARTPKKAVAKK
Subcellular Location(s) cyto_nucl 13.5, nucl 13, cyto 12
Family & Domain DBs
Amino Acid Sequences MPAKKTDSSDTPSVNGLRDNELRFIKAVFDNMTQKPDANWAQVATDLGLKDAKCAKERFRQMSVRHGWRSNTQATPGSSPGGKTKKNDVTGPSGDGKVTKKPKARTPKKAVAKKEESEDEDIKDEDDDFKEEEVEDGPFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.26
4 0.26
5 0.29
6 0.29
7 0.31
8 0.31
9 0.3
10 0.28
11 0.26
12 0.24
13 0.2
14 0.21
15 0.18
16 0.21
17 0.25
18 0.26
19 0.29
20 0.26
21 0.25
22 0.23
23 0.27
24 0.25
25 0.21
26 0.2
27 0.18
28 0.18
29 0.18
30 0.18
31 0.11
32 0.11
33 0.09
34 0.09
35 0.11
36 0.1
37 0.12
38 0.16
39 0.18
40 0.21
41 0.24
42 0.29
43 0.35
44 0.43
45 0.46
46 0.47
47 0.52
48 0.5
49 0.56
50 0.58
51 0.56
52 0.52
53 0.49
54 0.44
55 0.41
56 0.43
57 0.37
58 0.31
59 0.26
60 0.26
61 0.24
62 0.24
63 0.22
64 0.19
65 0.15
66 0.15
67 0.2
68 0.23
69 0.24
70 0.25
71 0.33
72 0.39
73 0.42
74 0.44
75 0.39
76 0.4
77 0.39
78 0.4
79 0.34
80 0.27
81 0.24
82 0.24
83 0.23
84 0.25
85 0.3
86 0.34
87 0.39
88 0.45
89 0.54
90 0.63
91 0.72
92 0.74
93 0.77
94 0.8
95 0.84
96 0.86
97 0.85
98 0.84
99 0.81
100 0.73
101 0.7
102 0.66
103 0.59
104 0.57
105 0.51
106 0.43
107 0.38
108 0.34
109 0.28
110 0.23
111 0.2
112 0.16
113 0.16
114 0.16
115 0.15
116 0.15
117 0.15
118 0.15
119 0.15
120 0.13