Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LK28

Protein Details
Accession A0A4S8LK28   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MRGVRIKKDQQNKDKRQRPTHQSSFDRTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRGVRIKKDQQNKDKRQRPTHQSSFDRTQVKTPLNLCPYPPIPSQHHSSLVTTELVSSPHFPLPSNSSLYSPAQRLVNTGPGTSSTSPSNFIQAEFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.89
4 0.89
5 0.87
6 0.87
7 0.85
8 0.84
9 0.8
10 0.78
11 0.73
12 0.7
13 0.65
14 0.55
15 0.5
16 0.47
17 0.43
18 0.4
19 0.36
20 0.36
21 0.37
22 0.36
23 0.32
24 0.31
25 0.3
26 0.3
27 0.3
28 0.27
29 0.26
30 0.29
31 0.33
32 0.3
33 0.32
34 0.29
35 0.27
36 0.23
37 0.2
38 0.18
39 0.13
40 0.11
41 0.08
42 0.08
43 0.08
44 0.09
45 0.1
46 0.11
47 0.12
48 0.12
49 0.14
50 0.18
51 0.2
52 0.22
53 0.21
54 0.2
55 0.23
56 0.25
57 0.26
58 0.22
59 0.23
60 0.21
61 0.2
62 0.22
63 0.21
64 0.26
65 0.24
66 0.23
67 0.21
68 0.2
69 0.25
70 0.24
71 0.24
72 0.2
73 0.2
74 0.24
75 0.24
76 0.27
77 0.23