Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V4HFK5

Protein Details
Accession A0A4V4HFK5   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MYRSSSPSTHHPKRQRVRLFLFCLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, E.R. 6, golg 6, nucl 3.5, pero 3, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032454  Histone_H2A_C  
Pfam View protein in Pfam  
PF16211  Histone_H2A_C  
Amino Acid Sequences MYRSSSPSTHHPKRQRVRLFLFCLSLYYILLLSKLLGDVFISEDSVVPQIESQLLPTKSGKGKKNEDLSQEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.83
4 0.82
5 0.8
6 0.77
7 0.68
8 0.6
9 0.49
10 0.41
11 0.34
12 0.26
13 0.17
14 0.11
15 0.09
16 0.07
17 0.07
18 0.06
19 0.05
20 0.04
21 0.04
22 0.04
23 0.03
24 0.03
25 0.03
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.07
33 0.06
34 0.05
35 0.05
36 0.06
37 0.07
38 0.07
39 0.08
40 0.15
41 0.16
42 0.18
43 0.19
44 0.25
45 0.31
46 0.39
47 0.44
48 0.45
49 0.54
50 0.6
51 0.69
52 0.69