Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8L3D9

Protein Details
Accession A0A4S8L3D9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTRSPRQTKRWPKRRGPHTLVLRYYHydrophilic
NLS Segment(s)
PositionSequence
10-14RWPKR
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTRSPRQTKRWPKRRGPHTLVLRYYYLGSLLVHSDFHVTQNLVSASLVLHYQPHPGIHDNTRILITRSRFSTTMTFQLKSANSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.87
4 0.86
5 0.85
6 0.83
7 0.75
8 0.68
9 0.59
10 0.49
11 0.42
12 0.32
13 0.22
14 0.14
15 0.11
16 0.09
17 0.09
18 0.08
19 0.08
20 0.08
21 0.09
22 0.08
23 0.09
24 0.1
25 0.09
26 0.08
27 0.1
28 0.1
29 0.09
30 0.08
31 0.07
32 0.06
33 0.06
34 0.06
35 0.04
36 0.06
37 0.06
38 0.08
39 0.08
40 0.09
41 0.11
42 0.14
43 0.18
44 0.2
45 0.25
46 0.24
47 0.25
48 0.26
49 0.25
50 0.24
51 0.26
52 0.26
53 0.25
54 0.27
55 0.3
56 0.29
57 0.31
58 0.35
59 0.33
60 0.39
61 0.39
62 0.37
63 0.33
64 0.4