Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MF66

Protein Details
Accession A0A4S8MF66    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
103-128MTRLALRKHRSYKKEFEKSYPRGRKABasic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001104  3-oxo-5_a-steroid_4-DH_C  
IPR039357  SRD5A/TECR  
Gene Ontology GO:0016020  C:membrane  
GO:0016627  F:oxidoreductase activity, acting on the CH-CH group of donors  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF02544  Steroid_dh  
PROSITE View protein in PROSITE  
PS50244  S5A_REDUCTASE  
Amino Acid Sequences MCPCMGRTSYPTNGVLSQTYLTLCDQCVLSTLKFFQISNLSTHLTFRSLRRRGDTTKAVPFGYGFGWVSCPNYLFEMLAWSVICLLSGNLAAWLFFTAGAFQMTRLALRKHRSYKKEFEKSYPRGRKAIFPFVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.24
4 0.2
5 0.16
6 0.15
7 0.14
8 0.13
9 0.13
10 0.12
11 0.11
12 0.11
13 0.1
14 0.12
15 0.14
16 0.13
17 0.14
18 0.15
19 0.17
20 0.18
21 0.18
22 0.17
23 0.2
24 0.21
25 0.2
26 0.22
27 0.2
28 0.19
29 0.2
30 0.18
31 0.16
32 0.17
33 0.2
34 0.28
35 0.31
36 0.34
37 0.38
38 0.42
39 0.44
40 0.49
41 0.51
42 0.45
43 0.46
44 0.45
45 0.4
46 0.35
47 0.31
48 0.25
49 0.18
50 0.14
51 0.09
52 0.07
53 0.08
54 0.08
55 0.09
56 0.09
57 0.09
58 0.08
59 0.09
60 0.09
61 0.08
62 0.07
63 0.08
64 0.08
65 0.08
66 0.07
67 0.06
68 0.06
69 0.06
70 0.06
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.04
85 0.05
86 0.07
87 0.06
88 0.06
89 0.08
90 0.09
91 0.11
92 0.14
93 0.17
94 0.23
95 0.3
96 0.39
97 0.47
98 0.57
99 0.63
100 0.68
101 0.75
102 0.79
103 0.83
104 0.78
105 0.77
106 0.78
107 0.78
108 0.82
109 0.81
110 0.75
111 0.72
112 0.7
113 0.7
114 0.67