Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8M3B4

Protein Details
Accession A0A4S8M3B4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-50SIYTLRRARRRWNKTGNVAKAKAHydrophilic
NLS Segment(s)
PositionSequence
33-57RRARRRWNKTGNVAKAKAIGRGRPR
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences KRIALKLHSRNQSIPLTTAEILKICDMSIYTLRRARRRWNKTGNVAKAKAIGRGRPRSLNDADVRSLLSLCRQQPVRFLDEYGQLLEKYRYNSVSLSVIHRAFIRAGISVKRIRKLASERSPEKIAEFIYHAAEYSPLQFVSIDEMSKDDRTYSRLFGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.38
3 0.34
4 0.31
5 0.3
6 0.25
7 0.2
8 0.19
9 0.17
10 0.15
11 0.1
12 0.1
13 0.09
14 0.11
15 0.17
16 0.18
17 0.23
18 0.27
19 0.33
20 0.4
21 0.45
22 0.52
23 0.58
24 0.64
25 0.69
26 0.75
27 0.78
28 0.81
29 0.86
30 0.84
31 0.82
32 0.74
33 0.64
34 0.6
35 0.52
36 0.48
37 0.41
38 0.37
39 0.38
40 0.44
41 0.46
42 0.46
43 0.48
44 0.47
45 0.46
46 0.46
47 0.41
48 0.36
49 0.34
50 0.28
51 0.26
52 0.2
53 0.18
54 0.12
55 0.11
56 0.13
57 0.13
58 0.16
59 0.18
60 0.18
61 0.24
62 0.27
63 0.28
64 0.24
65 0.24
66 0.22
67 0.22
68 0.22
69 0.17
70 0.15
71 0.11
72 0.12
73 0.12
74 0.13
75 0.12
76 0.13
77 0.14
78 0.14
79 0.14
80 0.15
81 0.16
82 0.15
83 0.16
84 0.18
85 0.17
86 0.17
87 0.17
88 0.16
89 0.14
90 0.14
91 0.12
92 0.1
93 0.12
94 0.13
95 0.17
96 0.22
97 0.26
98 0.28
99 0.29
100 0.28
101 0.33
102 0.39
103 0.45
104 0.48
105 0.54
106 0.54
107 0.57
108 0.59
109 0.52
110 0.46
111 0.38
112 0.29
113 0.22
114 0.21
115 0.17
116 0.17
117 0.16
118 0.15
119 0.13
120 0.14
121 0.12
122 0.11
123 0.12
124 0.09
125 0.1
126 0.1
127 0.1
128 0.15
129 0.16
130 0.14
131 0.13
132 0.15
133 0.18
134 0.19
135 0.2
136 0.16
137 0.17
138 0.21
139 0.25