Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9MQR1

Protein Details
Accession G9MQR1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-47GRPHVNGDKGKPPKQKKPKKPSPRDRSVIPDEKBasic
NLS Segment(s)
PositionSequence
22-38DKGKPPKQKKPKKPSPR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR006224  PsdUridine_synth_RluA-like_CS  
IPR006225  PsdUridine_synth_RluC/D  
IPR006145  PsdUridine_synth_RsuA/RluA  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
Pfam View protein in Pfam  
PF00849  PseudoU_synth_2  
PROSITE View protein in PROSITE  
PS01129  PSI_RLU  
PS50889  S4  
CDD cd02557  PseudoU_synth_ScRIB2  
Amino Acid Sequences MELDPAEVREYQPLGRPHVNGDKGKPPKQKKPKKPSPRDRSVIPDEKTVLITPAGDIWPRPYVFEDDLRRVQPYHFTYNTYCKERWRGRSLIDIFESEFRDRPVEYYRSSMVRGDIYVNGRVVGPDYIVRNGDMISHTLHRHEPPVTAEPIGIIHEDDDIIVINKPSGVPVHPAGRYNFNSVIEIMIADRGKDFLPHPCNRLDRLTSGIMFIAKSVKSAEAMAIKIRGRTVRKEYLARVVGHFPDGEVVCDQPILQISPKLGLNRVRANGKSARTVFKRLAYYPPLDGDADEPAMLAEDGRPHTPTNGEEHVQDETRKPWLKKKGYSIVRCLPVTGRTHQLRVHLQYLGHPIQNDPIYANQRVWGLNLGQADADGSQNTDEDIISRLNRMGKEEVAEAVVYYDEMVDRYEKQRAEKMTGELCDICDTPLYSDPGSHELSLWLHSLRYEDADGSWAYTSPLPKWALPPKGMSGPTTVGGMEELVEAVKDENPEISSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.39
4 0.42
5 0.49
6 0.55
7 0.53
8 0.54
9 0.57
10 0.61
11 0.69
12 0.72
13 0.72
14 0.76
15 0.82
16 0.88
17 0.89
18 0.91
19 0.93
20 0.94
21 0.96
22 0.96
23 0.96
24 0.95
25 0.9
26 0.84
27 0.82
28 0.8
29 0.78
30 0.69
31 0.64
32 0.55
33 0.51
34 0.47
35 0.39
36 0.3
37 0.21
38 0.19
39 0.14
40 0.15
41 0.15
42 0.14
43 0.13
44 0.15
45 0.21
46 0.21
47 0.22
48 0.21
49 0.25
50 0.28
51 0.35
52 0.38
53 0.39
54 0.44
55 0.44
56 0.43
57 0.39
58 0.37
59 0.38
60 0.37
61 0.39
62 0.35
63 0.38
64 0.41
65 0.49
66 0.55
67 0.52
68 0.48
69 0.46
70 0.55
71 0.59
72 0.64
73 0.61
74 0.59
75 0.56
76 0.64
77 0.61
78 0.57
79 0.5
80 0.42
81 0.36
82 0.35
83 0.36
84 0.27
85 0.25
86 0.21
87 0.2
88 0.2
89 0.21
90 0.24
91 0.25
92 0.25
93 0.27
94 0.29
95 0.3
96 0.31
97 0.3
98 0.25
99 0.22
100 0.21
101 0.19
102 0.2
103 0.21
104 0.22
105 0.21
106 0.19
107 0.18
108 0.17
109 0.16
110 0.12
111 0.1
112 0.1
113 0.12
114 0.13
115 0.14
116 0.14
117 0.13
118 0.12
119 0.13
120 0.11
121 0.11
122 0.11
123 0.14
124 0.15
125 0.16
126 0.2
127 0.19
128 0.22
129 0.22
130 0.21
131 0.23
132 0.27
133 0.26
134 0.23
135 0.22
136 0.19
137 0.18
138 0.17
139 0.12
140 0.08
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.05
151 0.06
152 0.06
153 0.07
154 0.07
155 0.08
156 0.1
157 0.13
158 0.18
159 0.19
160 0.22
161 0.23
162 0.29
163 0.3
164 0.31
165 0.31
166 0.26
167 0.26
168 0.23
169 0.21
170 0.15
171 0.13
172 0.08
173 0.09
174 0.08
175 0.07
176 0.07
177 0.08
178 0.08
179 0.09
180 0.1
181 0.15
182 0.23
183 0.26
184 0.28
185 0.33
186 0.35
187 0.36
188 0.39
189 0.33
190 0.26
191 0.28
192 0.27
193 0.22
194 0.2
195 0.18
196 0.15
197 0.12
198 0.11
199 0.1
200 0.08
201 0.09
202 0.09
203 0.09
204 0.09
205 0.09
206 0.11
207 0.1
208 0.1
209 0.11
210 0.14
211 0.14
212 0.14
213 0.15
214 0.19
215 0.19
216 0.24
217 0.3
218 0.33
219 0.36
220 0.39
221 0.4
222 0.42
223 0.43
224 0.39
225 0.34
226 0.29
227 0.26
228 0.23
229 0.21
230 0.13
231 0.12
232 0.11
233 0.1
234 0.08
235 0.08
236 0.07
237 0.07
238 0.07
239 0.05
240 0.05
241 0.05
242 0.06
243 0.07
244 0.07
245 0.09
246 0.11
247 0.11
248 0.14
249 0.18
250 0.22
251 0.25
252 0.28
253 0.3
254 0.29
255 0.32
256 0.34
257 0.31
258 0.33
259 0.31
260 0.35
261 0.34
262 0.38
263 0.36
264 0.35
265 0.37
266 0.32
267 0.36
268 0.32
269 0.31
270 0.28
271 0.26
272 0.23
273 0.2
274 0.18
275 0.13
276 0.11
277 0.1
278 0.08
279 0.07
280 0.05
281 0.06
282 0.05
283 0.04
284 0.04
285 0.07
286 0.08
287 0.09
288 0.11
289 0.11
290 0.12
291 0.13
292 0.14
293 0.16
294 0.18
295 0.18
296 0.17
297 0.19
298 0.2
299 0.2
300 0.2
301 0.16
302 0.15
303 0.22
304 0.28
305 0.28
306 0.34
307 0.43
308 0.51
309 0.55
310 0.62
311 0.65
312 0.68
313 0.71
314 0.71
315 0.67
316 0.64
317 0.58
318 0.5
319 0.42
320 0.37
321 0.36
322 0.31
323 0.32
324 0.29
325 0.32
326 0.33
327 0.37
328 0.38
329 0.38
330 0.38
331 0.31
332 0.3
333 0.3
334 0.35
335 0.32
336 0.27
337 0.24
338 0.22
339 0.24
340 0.25
341 0.22
342 0.16
343 0.19
344 0.22
345 0.23
346 0.23
347 0.2
348 0.21
349 0.21
350 0.21
351 0.18
352 0.14
353 0.15
354 0.16
355 0.14
356 0.12
357 0.11
358 0.11
359 0.09
360 0.09
361 0.06
362 0.06
363 0.06
364 0.06
365 0.07
366 0.07
367 0.06
368 0.06
369 0.08
370 0.1
371 0.1
372 0.11
373 0.14
374 0.18
375 0.18
376 0.22
377 0.23
378 0.22
379 0.23
380 0.23
381 0.21
382 0.18
383 0.17
384 0.13
385 0.1
386 0.09
387 0.07
388 0.06
389 0.05
390 0.05
391 0.05
392 0.06
393 0.08
394 0.11
395 0.14
396 0.2
397 0.22
398 0.26
399 0.32
400 0.35
401 0.39
402 0.4
403 0.42
404 0.42
405 0.41
406 0.4
407 0.34
408 0.31
409 0.28
410 0.24
411 0.2
412 0.16
413 0.16
414 0.15
415 0.19
416 0.21
417 0.18
418 0.19
419 0.21
420 0.24
421 0.25
422 0.23
423 0.19
424 0.18
425 0.19
426 0.19
427 0.18
428 0.15
429 0.13
430 0.13
431 0.15
432 0.14
433 0.16
434 0.15
435 0.14
436 0.14
437 0.16
438 0.16
439 0.15
440 0.15
441 0.12
442 0.13
443 0.15
444 0.17
445 0.15
446 0.22
447 0.23
448 0.24
449 0.32
450 0.4
451 0.44
452 0.45
453 0.47
454 0.46
455 0.51
456 0.51
457 0.44
458 0.39
459 0.35
460 0.32
461 0.29
462 0.24
463 0.16
464 0.15
465 0.14
466 0.1
467 0.08
468 0.07
469 0.06
470 0.06
471 0.06
472 0.07
473 0.09
474 0.1
475 0.1
476 0.12