Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8L1V0

Protein Details
Accession A0A4S8L1V0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-46EQTHGWPRTRKERRRTKSGQRRKESDABasic
NLS Segment(s)
PositionSequence
27-42RTRKERRRTKSGQRRK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MSKGHTQKKRTRNEYETDEEQTHGWPRTRKERRRTKSGQRRKESDALASSNTRGIETPNPLNSNHILSLLSARNHQRYRHIEGHTQKNEHETKRNAMNWARPGTPIEKKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.73
3 0.68
4 0.62
5 0.54
6 0.45
7 0.39
8 0.34
9 0.31
10 0.27
11 0.28
12 0.28
13 0.32
14 0.43
15 0.53
16 0.6
17 0.66
18 0.73
19 0.76
20 0.82
21 0.85
22 0.85
23 0.86
24 0.88
25 0.88
26 0.84
27 0.83
28 0.78
29 0.76
30 0.66
31 0.58
32 0.51
33 0.42
34 0.36
35 0.31
36 0.25
37 0.2
38 0.19
39 0.14
40 0.11
41 0.11
42 0.12
43 0.15
44 0.17
45 0.18
46 0.2
47 0.19
48 0.21
49 0.2
50 0.2
51 0.16
52 0.14
53 0.11
54 0.1
55 0.14
56 0.15
57 0.14
58 0.16
59 0.2
60 0.27
61 0.3
62 0.32
63 0.37
64 0.4
65 0.47
66 0.51
67 0.52
68 0.52
69 0.57
70 0.66
71 0.63
72 0.59
73 0.52
74 0.52
75 0.55
76 0.52
77 0.53
78 0.46
79 0.46
80 0.53
81 0.55
82 0.54
83 0.53
84 0.56
85 0.55
86 0.55
87 0.5
88 0.43
89 0.44
90 0.44
91 0.48