Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LEP5

Protein Details
Accession A0A4S8LEP5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-100IVNRLNKTKSRKRSGSMNKKGHydrophilic
NLS Segment(s)
PositionSequence
86-100KTKSRKRSGSMNKKG
Subcellular Location(s) extr 6, nucl 5, mito 5, cyto 5, cyto_nucl 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MPDKMTWDAIPESLLLLTDLTQLVKANSIEGNKKDNLYTPVANLKKTGDMTVGQVSFHTDKKVNNFEIPPAHIAKWENAIVNRLNKTKSRKRSGSMNKKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.07
4 0.07
5 0.07
6 0.08
7 0.07
8 0.08
9 0.08
10 0.08
11 0.11
12 0.1
13 0.1
14 0.13
15 0.15
16 0.2
17 0.22
18 0.26
19 0.24
20 0.25
21 0.24
22 0.25
23 0.25
24 0.24
25 0.23
26 0.2
27 0.28
28 0.28
29 0.28
30 0.25
31 0.22
32 0.21
33 0.21
34 0.2
35 0.12
36 0.11
37 0.13
38 0.15
39 0.14
40 0.12
41 0.11
42 0.13
43 0.14
44 0.14
45 0.14
46 0.13
47 0.15
48 0.22
49 0.28
50 0.27
51 0.29
52 0.29
53 0.3
54 0.31
55 0.31
56 0.27
57 0.24
58 0.22
59 0.21
60 0.22
61 0.2
62 0.22
63 0.21
64 0.21
65 0.2
66 0.23
67 0.25
68 0.29
69 0.33
70 0.33
71 0.35
72 0.38
73 0.48
74 0.55
75 0.61
76 0.66
77 0.68
78 0.69
79 0.76
80 0.81