Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LRT2

Protein Details
Accession A0A4S8LRT2    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
127-155DKKEKTEKKAKAPKSPKKEKKKEASETAABasic
222-251VEEPKEEKKEEKKEEKKEEKKEEKTPKAAKBasic
NLS Segment(s)
PositionSequence
119-149KLLAPFKGDKKEKTEKKAKAPKSPKKEKKKE
226-261KEEKKEEKKEEKKEEKKEEKTPKAAKVGRRLSARVG
Subcellular Location(s) cyto 12.5, cyto_nucl 12, nucl 10.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSAPESAAAAPVAPVEEVKPTEVVATEPTSVPAAEPAAPAIEVPKVEEPSAAPEAPKEEAKAEETPAVAEAPKVDEPAAESAPAEGAAATEEPAKEEAKEEAKAADAPKAPKSPSLLTKLLAPFKGDKKEKTEKKAKAPKSPKKEKKKEASETAAAPATEEPAKEAAKEEAAPATEAPAATEAAAEPAKAEETPAPAEPAKETETAAAPAEPVAEASAAAPVEEPKEEKKEEKKEEKKEEKKEEKTPKAAKVGRRLSARVGDFFKPKPKTEVSTPAKVDEHPPKIEEPAPVAPLENPASETAAPAAEEAKKEEPKEEAKKDEPAVEAAAPVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.12
4 0.13
5 0.14
6 0.14
7 0.13
8 0.14
9 0.14
10 0.14
11 0.14
12 0.15
13 0.15
14 0.15
15 0.16
16 0.16
17 0.16
18 0.15
19 0.13
20 0.13
21 0.12
22 0.12
23 0.11
24 0.11
25 0.11
26 0.11
27 0.1
28 0.1
29 0.09
30 0.12
31 0.16
32 0.17
33 0.17
34 0.18
35 0.18
36 0.22
37 0.26
38 0.23
39 0.18
40 0.18
41 0.2
42 0.22
43 0.23
44 0.18
45 0.16
46 0.18
47 0.21
48 0.22
49 0.21
50 0.2
51 0.19
52 0.18
53 0.17
54 0.16
55 0.12
56 0.1
57 0.09
58 0.11
59 0.12
60 0.12
61 0.11
62 0.11
63 0.13
64 0.16
65 0.16
66 0.12
67 0.11
68 0.11
69 0.11
70 0.11
71 0.09
72 0.05
73 0.04
74 0.05
75 0.05
76 0.05
77 0.07
78 0.07
79 0.08
80 0.1
81 0.1
82 0.09
83 0.11
84 0.14
85 0.15
86 0.16
87 0.16
88 0.15
89 0.15
90 0.18
91 0.17
92 0.19
93 0.19
94 0.21
95 0.25
96 0.28
97 0.27
98 0.27
99 0.31
100 0.3
101 0.32
102 0.36
103 0.33
104 0.3
105 0.35
106 0.37
107 0.36
108 0.32
109 0.28
110 0.27
111 0.3
112 0.39
113 0.37
114 0.36
115 0.41
116 0.51
117 0.56
118 0.6
119 0.65
120 0.62
121 0.69
122 0.76
123 0.75
124 0.75
125 0.79
126 0.79
127 0.8
128 0.85
129 0.85
130 0.86
131 0.9
132 0.89
133 0.88
134 0.89
135 0.85
136 0.81
137 0.76
138 0.68
139 0.58
140 0.5
141 0.41
142 0.31
143 0.23
144 0.16
145 0.12
146 0.1
147 0.09
148 0.08
149 0.09
150 0.09
151 0.09
152 0.1
153 0.09
154 0.09
155 0.1
156 0.09
157 0.08
158 0.08
159 0.08
160 0.07
161 0.08
162 0.07
163 0.07
164 0.07
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.06
171 0.06
172 0.06
173 0.05
174 0.05
175 0.06
176 0.05
177 0.07
178 0.06
179 0.08
180 0.1
181 0.1
182 0.12
183 0.12
184 0.13
185 0.12
186 0.14
187 0.14
188 0.13
189 0.13
190 0.11
191 0.12
192 0.13
193 0.13
194 0.1
195 0.08
196 0.07
197 0.07
198 0.06
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.07
210 0.07
211 0.09
212 0.11
213 0.16
214 0.18
215 0.24
216 0.32
217 0.41
218 0.5
219 0.6
220 0.66
221 0.72
222 0.81
223 0.86
224 0.86
225 0.87
226 0.88
227 0.87
228 0.85
229 0.85
230 0.85
231 0.82
232 0.82
233 0.79
234 0.74
235 0.73
236 0.72
237 0.68
238 0.68
239 0.67
240 0.64
241 0.62
242 0.57
243 0.52
244 0.53
245 0.49
246 0.43
247 0.4
248 0.38
249 0.38
250 0.4
251 0.45
252 0.42
253 0.42
254 0.44
255 0.44
256 0.45
257 0.47
258 0.54
259 0.52
260 0.56
261 0.55
262 0.53
263 0.5
264 0.46
265 0.47
266 0.45
267 0.44
268 0.38
269 0.39
270 0.36
271 0.39
272 0.41
273 0.35
274 0.31
275 0.29
276 0.28
277 0.26
278 0.25
279 0.22
280 0.24
281 0.24
282 0.19
283 0.16
284 0.16
285 0.18
286 0.17
287 0.17
288 0.14
289 0.12
290 0.12
291 0.11
292 0.13
293 0.13
294 0.14
295 0.18
296 0.24
297 0.28
298 0.29
299 0.32
300 0.35
301 0.42
302 0.51
303 0.53
304 0.54
305 0.53
306 0.59
307 0.6
308 0.58
309 0.5
310 0.43
311 0.39
312 0.31
313 0.27
314 0.2
315 0.17