Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KY78

Protein Details
Accession A0A4S8KY78   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
111-154APNLPLQRCRKSRCTKKPPPNQHRKMKRTNQKKTSQLQHPICRVHydrophilic
NLS Segment(s)
PositionSequence
126-138KKPPPNQHRKMKR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036279  5-3_exonuclease_C_sf  
IPR029060  PIN-like_dom_sf  
IPR006086  XPG-I_dom  
IPR006084  XPG/Rad2  
Gene Ontology GO:0004518  F:nuclease activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF00867  XPG_I  
Amino Acid Sequences APSEAEAQCAELARGGNGSEDMDTLTFNAPILFRHLTFSEAKKQPISEINLQAALKGLDKDMSQDVGPKSALKLIREHGSLDKVVEHLRAKYVFLRCLLSSLDSLFHPRSAPNLPLQRCRKSRCTKKPPPNQHRKMKRTNQKKTSQLQHPICRVSWQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.1
5 0.11
6 0.09
7 0.09
8 0.09
9 0.08
10 0.08
11 0.09
12 0.09
13 0.08
14 0.08
15 0.09
16 0.08
17 0.08
18 0.14
19 0.14
20 0.14
21 0.17
22 0.17
23 0.19
24 0.22
25 0.26
26 0.3
27 0.32
28 0.34
29 0.33
30 0.32
31 0.33
32 0.35
33 0.37
34 0.34
35 0.33
36 0.32
37 0.33
38 0.33
39 0.3
40 0.24
41 0.19
42 0.14
43 0.11
44 0.1
45 0.08
46 0.08
47 0.1
48 0.1
49 0.1
50 0.09
51 0.14
52 0.14
53 0.14
54 0.14
55 0.13
56 0.12
57 0.15
58 0.17
59 0.14
60 0.16
61 0.17
62 0.19
63 0.2
64 0.21
65 0.18
66 0.18
67 0.17
68 0.15
69 0.13
70 0.11
71 0.11
72 0.12
73 0.12
74 0.1
75 0.13
76 0.13
77 0.14
78 0.18
79 0.2
80 0.19
81 0.19
82 0.21
83 0.19
84 0.2
85 0.2
86 0.16
87 0.13
88 0.12
89 0.12
90 0.1
91 0.13
92 0.13
93 0.13
94 0.12
95 0.12
96 0.15
97 0.17
98 0.18
99 0.22
100 0.3
101 0.33
102 0.42
103 0.49
104 0.54
105 0.59
106 0.63
107 0.66
108 0.69
109 0.77
110 0.79
111 0.83
112 0.85
113 0.89
114 0.93
115 0.95
116 0.95
117 0.95
118 0.94
119 0.94
120 0.94
121 0.92
122 0.92
123 0.91
124 0.91
125 0.91
126 0.92
127 0.91
128 0.89
129 0.89
130 0.87
131 0.87
132 0.85
133 0.85
134 0.83
135 0.83
136 0.8
137 0.74
138 0.66