Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LDS5

Protein Details
Accession E2LDS5   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
149-171QNLVGNKRQRKRGPSKNAKAEEEHydrophilic
NLS Segment(s)
PositionSequence
158-167KRQRKRGPSK
Subcellular Location(s) nucl 10cyto 10cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
KEGG mpr:MPER_04444  -  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS50039  FORK_HEAD_3  
CDD cd00059  FH_FOX  
Amino Acid Sequences GFSLLDKDDNIWINEFFNGPXSPTNIKHLASIHRLPGIETPKQRRSAXSHNISGGTPVKISTLHMPLAGEKLAYSYSILIQLAXWESPNKRLTLQEIYAAILKKFPVFREQGDAWQRSIRHTLSLKKAFVNQGRDRQDLPKGRGAYWELDVQNLVGNKRQRKRGPSKNAKAEEEEDDESIDQEEPVMRGRPAPLDMVWRLVDRLLRGHNGLLHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.15
4 0.19
5 0.2
6 0.19
7 0.22
8 0.24
9 0.25
10 0.29
11 0.32
12 0.27
13 0.28
14 0.31
15 0.34
16 0.38
17 0.39
18 0.37
19 0.37
20 0.36
21 0.33
22 0.35
23 0.34
24 0.34
25 0.39
26 0.45
27 0.48
28 0.55
29 0.55
30 0.52
31 0.55
32 0.6
33 0.58
34 0.58
35 0.54
36 0.48
37 0.48
38 0.47
39 0.41
40 0.3
41 0.23
42 0.15
43 0.13
44 0.12
45 0.13
46 0.14
47 0.15
48 0.15
49 0.15
50 0.15
51 0.15
52 0.17
53 0.15
54 0.1
55 0.07
56 0.08
57 0.07
58 0.07
59 0.07
60 0.06
61 0.06
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.1
70 0.09
71 0.12
72 0.16
73 0.17
74 0.17
75 0.17
76 0.2
77 0.23
78 0.22
79 0.22
80 0.19
81 0.19
82 0.21
83 0.2
84 0.16
85 0.12
86 0.12
87 0.11
88 0.12
89 0.12
90 0.14
91 0.15
92 0.16
93 0.21
94 0.22
95 0.26
96 0.31
97 0.31
98 0.27
99 0.28
100 0.28
101 0.24
102 0.27
103 0.21
104 0.2
105 0.23
106 0.28
107 0.34
108 0.39
109 0.38
110 0.36
111 0.39
112 0.4
113 0.42
114 0.45
115 0.41
116 0.44
117 0.48
118 0.48
119 0.47
120 0.44
121 0.47
122 0.45
123 0.44
124 0.42
125 0.39
126 0.37
127 0.39
128 0.38
129 0.32
130 0.27
131 0.28
132 0.22
133 0.2
134 0.2
135 0.17
136 0.17
137 0.16
138 0.15
139 0.15
140 0.21
141 0.3
142 0.36
143 0.45
144 0.5
145 0.59
146 0.69
147 0.74
148 0.79
149 0.82
150 0.86
151 0.87
152 0.86
153 0.79
154 0.73
155 0.65
156 0.58
157 0.52
158 0.43
159 0.33
160 0.28
161 0.25
162 0.21
163 0.19
164 0.14
165 0.09
166 0.08
167 0.09
168 0.08
169 0.12
170 0.14
171 0.13
172 0.14
173 0.16
174 0.19
175 0.19
176 0.21
177 0.2
178 0.24
179 0.25
180 0.27
181 0.27
182 0.24
183 0.24
184 0.23
185 0.24
186 0.19
187 0.24
188 0.24
189 0.26
190 0.27
191 0.29