Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MD81

Protein Details
Accession A0A4S8MD81    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLFDRERRRRRKKRNRMCNDTPRIHLBasic
NLS Segment(s)
PositionSequence
6-15ERRRRRKKRN
Subcellular Location(s) nucl 12, mito 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016169  FAD-bd_PCMH_sub2  
Amino Acid Sequences MLFDRERRRRRKKRNRMCNDTPRIHLAFLRSLVLPQWETCQRSSQKCLLDSMQPNNSAAWEGMDCEQGSVSPRYIDVRSAEDVQIAFRFAQQTGVMLSIKASGHDFKGRSGAPGSLGLWARLPLHRWYHFVADI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.97
3 0.95
4 0.95
5 0.94
6 0.92
7 0.86
8 0.78
9 0.73
10 0.64
11 0.55
12 0.45
13 0.37
14 0.31
15 0.27
16 0.25
17 0.19
18 0.17
19 0.17
20 0.18
21 0.16
22 0.13
23 0.17
24 0.2
25 0.22
26 0.23
27 0.3
28 0.33
29 0.37
30 0.41
31 0.42
32 0.41
33 0.4
34 0.41
35 0.35
36 0.37
37 0.36
38 0.36
39 0.34
40 0.3
41 0.3
42 0.27
43 0.25
44 0.19
45 0.14
46 0.1
47 0.06
48 0.07
49 0.07
50 0.08
51 0.08
52 0.07
53 0.07
54 0.06
55 0.09
56 0.09
57 0.08
58 0.07
59 0.08
60 0.1
61 0.11
62 0.12
63 0.12
64 0.14
65 0.15
66 0.17
67 0.17
68 0.15
69 0.15
70 0.14
71 0.13
72 0.11
73 0.09
74 0.08
75 0.09
76 0.08
77 0.11
78 0.09
79 0.1
80 0.09
81 0.11
82 0.1
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.11
89 0.11
90 0.14
91 0.2
92 0.2
93 0.19
94 0.24
95 0.24
96 0.24
97 0.24
98 0.22
99 0.19
100 0.2
101 0.2
102 0.19
103 0.2
104 0.18
105 0.17
106 0.18
107 0.18
108 0.18
109 0.21
110 0.22
111 0.3
112 0.32
113 0.35
114 0.37