Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LC17

Protein Details
Accession A0A4S8LC17    Localization Confidence High Confidence Score 20.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-62AANPVKRGRGRPKGSKNKKTSSSAHydrophilic
67-111DTPSVPRKRGRPPKPKPAEESGNEEPAQKRKRGRPPKNPKPTDATBasic
119-140EADSSAPKKRGRPPKNPPSSSTHydrophilic
NLS Segment(s)
PositionSequence
43-107VKRGRGRPKGSKNKKTSSSAPAASDTPSVPRKRGRPPKPKPAEESGNEEPAQKRKRGRPPKNPKP
125-134PKKRGRPPKN
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSSSPNPNEDHLDKPTNEGDELDDSQDPNSPDQAAPTSAANPVKRGRGRPKGSKNKKTSSSAPAASDTPSVPRKRGRPPKPKPAEESGNEEPAQKRKRGRPPKNPKPTDATSASAPATEADSSAPKKRGRPPKNPPSSST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.34
4 0.32
5 0.28
6 0.24
7 0.22
8 0.23
9 0.21
10 0.19
11 0.17
12 0.17
13 0.2
14 0.19
15 0.15
16 0.16
17 0.15
18 0.14
19 0.15
20 0.17
21 0.14
22 0.14
23 0.14
24 0.14
25 0.16
26 0.21
27 0.19
28 0.21
29 0.23
30 0.3
31 0.32
32 0.39
33 0.45
34 0.51
35 0.58
36 0.65
37 0.73
38 0.77
39 0.84
40 0.86
41 0.84
42 0.82
43 0.8
44 0.75
45 0.69
46 0.64
47 0.59
48 0.51
49 0.44
50 0.38
51 0.32
52 0.28
53 0.23
54 0.17
55 0.16
56 0.19
57 0.19
58 0.2
59 0.24
60 0.29
61 0.38
62 0.49
63 0.56
64 0.61
65 0.69
66 0.77
67 0.82
68 0.82
69 0.76
70 0.73
71 0.69
72 0.6
73 0.6
74 0.51
75 0.46
76 0.41
77 0.38
78 0.33
79 0.35
80 0.36
81 0.33
82 0.37
83 0.43
84 0.54
85 0.63
86 0.72
87 0.75
88 0.82
89 0.89
90 0.93
91 0.88
92 0.81
93 0.78
94 0.71
95 0.66
96 0.59
97 0.5
98 0.41
99 0.39
100 0.34
101 0.26
102 0.22
103 0.16
104 0.14
105 0.12
106 0.1
107 0.09
108 0.15
109 0.18
110 0.25
111 0.31
112 0.32
113 0.4
114 0.49
115 0.59
116 0.63
117 0.71
118 0.75
119 0.8
120 0.88