Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8M2X3

Protein Details
Accession A0A4S8M2X3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
214-240PKNVFAFPRRKGKIKKITKTRMIYYTRHydrophilic
NLS Segment(s)
PositionSequence
222-230RRKGKIKKI
Subcellular Location(s) mito 11.5, mito_nucl 10.333, nucl 8, cyto_nucl 5.833, plas 5
Family & Domain DBs
Amino Acid Sequences MSIGCMRTHWDPSRLSAQHTCMKWHRSLLASLHTQNPYTALMVSLLAVTTVKPQPIVATSLMSLSPDFQTQLRGKWVCVYTLGGKGSIISFSPSRFRVAPQSLVVKFVEVFLGKVRFLLALLTAHITSRHVCGDIFYSSITTSPSGGLTVQKFDISDISSFFTVVPTWYSVSGSFFLWSSLNAYASLNFLPLTPTSYFTHPLITTPDLFGSESPKNVFAFPRRKGKIKKITKTRMIYYTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.45
4 0.46
5 0.48
6 0.47
7 0.5
8 0.47
9 0.51
10 0.48
11 0.47
12 0.45
13 0.41
14 0.44
15 0.4
16 0.39
17 0.4
18 0.39
19 0.41
20 0.38
21 0.36
22 0.31
23 0.29
24 0.24
25 0.2
26 0.17
27 0.11
28 0.1
29 0.1
30 0.1
31 0.08
32 0.06
33 0.06
34 0.05
35 0.05
36 0.1
37 0.11
38 0.12
39 0.12
40 0.12
41 0.13
42 0.15
43 0.17
44 0.13
45 0.13
46 0.12
47 0.13
48 0.13
49 0.12
50 0.11
51 0.09
52 0.09
53 0.09
54 0.1
55 0.09
56 0.15
57 0.16
58 0.19
59 0.25
60 0.25
61 0.25
62 0.3
63 0.3
64 0.24
65 0.24
66 0.24
67 0.19
68 0.22
69 0.22
70 0.16
71 0.15
72 0.15
73 0.14
74 0.12
75 0.1
76 0.08
77 0.08
78 0.09
79 0.13
80 0.14
81 0.16
82 0.16
83 0.17
84 0.23
85 0.25
86 0.26
87 0.25
88 0.31
89 0.28
90 0.3
91 0.28
92 0.21
93 0.18
94 0.15
95 0.14
96 0.08
97 0.08
98 0.08
99 0.1
100 0.09
101 0.09
102 0.09
103 0.07
104 0.07
105 0.07
106 0.05
107 0.04
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.08
119 0.08
120 0.1
121 0.1
122 0.1
123 0.08
124 0.08
125 0.08
126 0.08
127 0.09
128 0.07
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.1
135 0.1
136 0.11
137 0.11
138 0.11
139 0.11
140 0.11
141 0.12
142 0.1
143 0.1
144 0.09
145 0.1
146 0.1
147 0.1
148 0.1
149 0.09
150 0.08
151 0.08
152 0.08
153 0.08
154 0.09
155 0.09
156 0.1
157 0.1
158 0.12
159 0.12
160 0.11
161 0.11
162 0.1
163 0.1
164 0.1
165 0.1
166 0.1
167 0.1
168 0.1
169 0.1
170 0.11
171 0.1
172 0.12
173 0.12
174 0.1
175 0.09
176 0.08
177 0.09
178 0.09
179 0.12
180 0.12
181 0.15
182 0.17
183 0.2
184 0.23
185 0.22
186 0.26
187 0.22
188 0.23
189 0.24
190 0.25
191 0.23
192 0.21
193 0.21
194 0.18
195 0.18
196 0.17
197 0.19
198 0.18
199 0.2
200 0.21
201 0.22
202 0.22
203 0.24
204 0.29
205 0.33
206 0.4
207 0.44
208 0.53
209 0.56
210 0.65
211 0.72
212 0.77
213 0.79
214 0.81
215 0.84
216 0.84
217 0.9
218 0.9
219 0.88
220 0.84