Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LJV2

Protein Details
Accession A0A4S8LJV2   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
79-98DSCNICQKSKPRRHAPLGLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041588  Integrase_H2C2  
Pfam View protein in Pfam  
PF17921  Integrase_H2C2  
Amino Acid Sequences MLNPHHSHYHYSGDGLLYFEDWNGNNRLCVPACLRAEVMAEVHDGKSESAHGGYHRCYNRLSSTYYWPRMSRELKQFIDSCNICQKSKPRRHAPLGLLQPIPIPER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.19
3 0.16
4 0.11
5 0.1
6 0.09
7 0.1
8 0.09
9 0.12
10 0.15
11 0.15
12 0.14
13 0.15
14 0.19
15 0.17
16 0.19
17 0.19
18 0.23
19 0.24
20 0.25
21 0.24
22 0.21
23 0.21
24 0.19
25 0.16
26 0.09
27 0.09
28 0.08
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.07
38 0.07
39 0.09
40 0.1
41 0.17
42 0.17
43 0.18
44 0.18
45 0.2
46 0.23
47 0.23
48 0.26
49 0.22
50 0.3
51 0.36
52 0.4
53 0.41
54 0.38
55 0.39
56 0.43
57 0.45
58 0.43
59 0.44
60 0.48
61 0.47
62 0.5
63 0.49
64 0.43
65 0.47
66 0.4
67 0.35
68 0.36
69 0.38
70 0.34
71 0.37
72 0.45
73 0.48
74 0.57
75 0.64
76 0.65
77 0.72
78 0.79
79 0.83
80 0.79
81 0.78
82 0.76
83 0.71
84 0.61
85 0.51
86 0.45