Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LKB7

Protein Details
Accession A0A4S8LKB7   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-127MRKREIGESGCRRRRRRRRRSWTFWVQRRCWWWHydrophilic
NLS Segment(s)
PositionSequence
105-114CRRRRRRRRR
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MDPVVKIISADGELVFFSHLRQVSNDNGLFVLIKHLFCCVKHAKSSYLKSPPAPSSYPTLTSDAHSPAPISPLPCLNLINFDFLLDIVPRDIGGMRKREIGESGCRRRRRRRRRSWTFWVQRRCWWWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.11
6 0.12
7 0.13
8 0.15
9 0.18
10 0.2
11 0.27
12 0.27
13 0.23
14 0.21
15 0.21
16 0.19
17 0.16
18 0.18
19 0.13
20 0.13
21 0.12
22 0.15
23 0.16
24 0.16
25 0.22
26 0.23
27 0.24
28 0.29
29 0.31
30 0.35
31 0.41
32 0.46
33 0.47
34 0.48
35 0.47
36 0.45
37 0.47
38 0.43
39 0.39
40 0.36
41 0.3
42 0.28
43 0.27
44 0.27
45 0.24
46 0.24
47 0.21
48 0.2
49 0.21
50 0.18
51 0.17
52 0.14
53 0.12
54 0.1
55 0.12
56 0.12
57 0.11
58 0.09
59 0.11
60 0.12
61 0.12
62 0.13
63 0.11
64 0.14
65 0.14
66 0.15
67 0.14
68 0.12
69 0.11
70 0.11
71 0.12
72 0.08
73 0.07
74 0.05
75 0.05
76 0.05
77 0.05
78 0.07
79 0.11
80 0.16
81 0.2
82 0.21
83 0.26
84 0.27
85 0.27
86 0.29
87 0.28
88 0.34
89 0.4
90 0.49
91 0.53
92 0.62
93 0.69
94 0.78
95 0.85
96 0.86
97 0.88
98 0.88
99 0.91
100 0.94
101 0.95
102 0.94
103 0.94
104 0.94
105 0.92
106 0.91
107 0.84
108 0.81