Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KJW7

Protein Details
Accession A0A4S8KJW7   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-113ERAKLEKERLERQRQFRKARGLDBasic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003903  UIM_dom  
Pfam View protein in Pfam  
PF02809  UIM  
PROSITE View protein in PROSITE  
PS50330  UIM  
Amino Acid Sequences MDSYEDDMARAIALSLQDQTSNVSNSSVNDLEDIGVDDEFDEQLRMAVEASKKDSTPTVAPPAPTIAKKPEATPERSHIDTTPATASFLSERAKLEKERLERQRQFRKARGLDERLPPDLLSTGIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.1
5 0.1
6 0.13
7 0.14
8 0.15
9 0.14
10 0.14
11 0.14
12 0.15
13 0.2
14 0.18
15 0.15
16 0.14
17 0.14
18 0.12
19 0.12
20 0.12
21 0.08
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.04
30 0.05
31 0.05
32 0.05
33 0.05
34 0.08
35 0.09
36 0.11
37 0.15
38 0.15
39 0.15
40 0.16
41 0.16
42 0.16
43 0.17
44 0.18
45 0.19
46 0.2
47 0.2
48 0.19
49 0.21
50 0.2
51 0.19
52 0.18
53 0.16
54 0.19
55 0.19
56 0.2
57 0.26
58 0.29
59 0.33
60 0.34
61 0.35
62 0.36
63 0.36
64 0.36
65 0.28
66 0.28
67 0.24
68 0.22
69 0.2
70 0.15
71 0.15
72 0.13
73 0.14
74 0.1
75 0.13
76 0.13
77 0.13
78 0.14
79 0.17
80 0.2
81 0.21
82 0.26
83 0.3
84 0.35
85 0.43
86 0.51
87 0.59
88 0.64
89 0.72
90 0.78
91 0.8
92 0.82
93 0.8
94 0.82
95 0.76
96 0.77
97 0.76
98 0.73
99 0.7
100 0.71
101 0.69
102 0.61
103 0.56
104 0.47
105 0.39
106 0.32