Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KTA0

Protein Details
Accession A0A4S8KTA0    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-33REQTVEERKKSKEKKRKPSISKQNNHTKNGBasic
NLS Segment(s)
PositionSequence
11-22RKKSKEKKRKPS
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011650  Peptidase_M20_dimer  
Pfam View protein in Pfam  
PF07687  M20_dimer  
Amino Acid Sequences MINREQTVEERKKSKEKKRKPSISKQNNHTKNGTTQALDLISGGVKTNALPERASAVINHQISTLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.77
4 0.82
5 0.87
6 0.93
7 0.92
8 0.93
9 0.93
10 0.93
11 0.9
12 0.88
13 0.87
14 0.83
15 0.77
16 0.68
17 0.58
18 0.5
19 0.47
20 0.39
21 0.29
22 0.22
23 0.2
24 0.18
25 0.15
26 0.12
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.1
35 0.13
36 0.14
37 0.14
38 0.14
39 0.18
40 0.19
41 0.2
42 0.15
43 0.17
44 0.24
45 0.25
46 0.25