Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LGM3

Protein Details
Accession A0A4S8LGM3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-108MAFLRRRKREGKLKKMTEGTBasic
NLS Segment(s)
PositionSequence
93-103RRRKREGKLKK
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
Amino Acid Sequences MCISITYACLARRVEWLLSLPLHPDLYAHLNLEPLKFAHVPVLLNADGKKMSTGNGDVQVVDYVAPMIAQSTSSLDATKLEYINKYYVMAFLRRRKREGKLKKMTEGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.24
4 0.23
5 0.23
6 0.22
7 0.19
8 0.18
9 0.17
10 0.15
11 0.13
12 0.12
13 0.15
14 0.16
15 0.15
16 0.13
17 0.15
18 0.17
19 0.17
20 0.15
21 0.11
22 0.13
23 0.12
24 0.12
25 0.12
26 0.13
27 0.13
28 0.12
29 0.16
30 0.12
31 0.13
32 0.13
33 0.12
34 0.11
35 0.1
36 0.1
37 0.07
38 0.08
39 0.08
40 0.09
41 0.1
42 0.12
43 0.12
44 0.11
45 0.11
46 0.11
47 0.09
48 0.08
49 0.06
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.05
59 0.07
60 0.07
61 0.08
62 0.08
63 0.09
64 0.1
65 0.13
66 0.12
67 0.13
68 0.14
69 0.17
70 0.18
71 0.18
72 0.17
73 0.15
74 0.18
75 0.18
76 0.23
77 0.29
78 0.37
79 0.46
80 0.51
81 0.56
82 0.6
83 0.67
84 0.72
85 0.75
86 0.76
87 0.77
88 0.79