Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KIQ7

Protein Details
Accession A0A4S8KIQ7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
82-102IEDSRPSKKKKVPTRSTQLQGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MRPKPACPLAYVRSNKTGPPPLRSRPNPLATSTACAPLPVMKSTNPDFTRASTVVGSFVDKYGSGRRSNASGLKRTVEEADIEDSRPSKKKKVPTRSTQLQGPEPSSLSLPAKAQSRIQRKMINKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.49
4 0.53
5 0.47
6 0.5
7 0.53
8 0.53
9 0.63
10 0.64
11 0.66
12 0.65
13 0.68
14 0.62
15 0.57
16 0.55
17 0.45
18 0.45
19 0.38
20 0.32
21 0.24
22 0.22
23 0.2
24 0.18
25 0.19
26 0.16
27 0.16
28 0.15
29 0.2
30 0.22
31 0.31
32 0.28
33 0.28
34 0.28
35 0.28
36 0.31
37 0.27
38 0.26
39 0.18
40 0.17
41 0.15
42 0.14
43 0.13
44 0.08
45 0.08
46 0.07
47 0.06
48 0.08
49 0.12
50 0.15
51 0.15
52 0.16
53 0.17
54 0.18
55 0.21
56 0.25
57 0.24
58 0.26
59 0.26
60 0.27
61 0.26
62 0.25
63 0.24
64 0.19
65 0.15
66 0.13
67 0.15
68 0.14
69 0.14
70 0.14
71 0.14
72 0.17
73 0.23
74 0.25
75 0.29
76 0.35
77 0.44
78 0.54
79 0.65
80 0.71
81 0.74
82 0.81
83 0.81
84 0.8
85 0.75
86 0.69
87 0.64
88 0.58
89 0.5
90 0.42
91 0.34
92 0.31
93 0.27
94 0.25
95 0.2
96 0.19
97 0.18
98 0.2
99 0.24
100 0.25
101 0.31
102 0.38
103 0.46
104 0.5
105 0.56
106 0.61