Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MIW7

Protein Details
Accession A0A4S8MIW7    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-49SSLQKHRSTSQKCSKVKPKLKPVAARRKDKIPRAHydrophilic
NLS Segment(s)
PositionSequence
30-48KVKPKLKPVAARRKDKIPR
Subcellular Location(s) nucl 11cyto_nucl 11, mito 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MAFECPSCGKPFSNGSSLQKHRSTSQKCSKVKPKLKPVAARRKDKIPRASGSVDPVTEGEPSLGMNIEEHLDMVIDEPSPSATTELPPAPPPPTKPPTNALRPSRTGLLYNFLKDHHPPTLPSTEVPDQVPYPVPESTPESVGLPEFVYVDTDPDEFGIYRSYPTLPKSIPDEEIPLVDICEGSGFPCPPPLEPLSIFGSFAKKIQNAFAPFLNPSIFRLMAWFYNGHESKSFADLDNLVDNVIMADDFKKEDLKGFRAKKVARDMDEYLGPRFSFEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.51
4 0.55
5 0.58
6 0.55
7 0.53
8 0.54
9 0.59
10 0.59
11 0.6
12 0.65
13 0.68
14 0.69
15 0.77
16 0.81
17 0.81
18 0.84
19 0.84
20 0.84
21 0.84
22 0.87
23 0.87
24 0.87
25 0.87
26 0.87
27 0.86
28 0.8
29 0.8
30 0.8
31 0.79
32 0.78
33 0.74
34 0.69
35 0.65
36 0.65
37 0.56
38 0.53
39 0.46
40 0.37
41 0.3
42 0.26
43 0.21
44 0.17
45 0.15
46 0.09
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.06
57 0.06
58 0.05
59 0.05
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.12
72 0.13
73 0.14
74 0.15
75 0.16
76 0.19
77 0.2
78 0.24
79 0.29
80 0.33
81 0.35
82 0.36
83 0.41
84 0.45
85 0.52
86 0.56
87 0.54
88 0.53
89 0.53
90 0.52
91 0.49
92 0.42
93 0.35
94 0.28
95 0.28
96 0.24
97 0.23
98 0.21
99 0.19
100 0.2
101 0.19
102 0.21
103 0.18
104 0.17
105 0.17
106 0.2
107 0.23
108 0.21
109 0.2
110 0.23
111 0.21
112 0.22
113 0.21
114 0.18
115 0.15
116 0.16
117 0.17
118 0.12
119 0.12
120 0.11
121 0.11
122 0.11
123 0.15
124 0.14
125 0.14
126 0.14
127 0.12
128 0.12
129 0.12
130 0.11
131 0.07
132 0.06
133 0.05
134 0.05
135 0.06
136 0.05
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.07
143 0.06
144 0.06
145 0.07
146 0.06
147 0.07
148 0.08
149 0.09
150 0.11
151 0.13
152 0.16
153 0.15
154 0.16
155 0.21
156 0.22
157 0.22
158 0.21
159 0.22
160 0.19
161 0.19
162 0.18
163 0.14
164 0.12
165 0.1
166 0.08
167 0.05
168 0.05
169 0.05
170 0.04
171 0.07
172 0.07
173 0.07
174 0.12
175 0.13
176 0.13
177 0.17
178 0.18
179 0.19
180 0.19
181 0.22
182 0.22
183 0.22
184 0.22
185 0.19
186 0.2
187 0.17
188 0.18
189 0.19
190 0.17
191 0.18
192 0.2
193 0.26
194 0.26
195 0.28
196 0.28
197 0.25
198 0.24
199 0.25
200 0.23
201 0.17
202 0.15
203 0.17
204 0.16
205 0.14
206 0.15
207 0.15
208 0.15
209 0.17
210 0.16
211 0.13
212 0.23
213 0.24
214 0.24
215 0.23
216 0.24
217 0.24
218 0.26
219 0.26
220 0.17
221 0.18
222 0.17
223 0.19
224 0.19
225 0.17
226 0.14
227 0.12
228 0.12
229 0.09
230 0.09
231 0.06
232 0.04
233 0.05
234 0.07
235 0.08
236 0.09
237 0.11
238 0.12
239 0.19
240 0.24
241 0.3
242 0.38
243 0.43
244 0.48
245 0.55
246 0.58
247 0.59
248 0.64
249 0.66
250 0.61
251 0.61
252 0.58
253 0.54
254 0.57
255 0.51
256 0.42
257 0.37
258 0.33