Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N7S5

Protein Details
Accession G9N7S5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRLRLRAVDSVHydrophilic
76-105DKYTMFDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
29-29R
84-96KEKKYRKGIHKLP
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRATNPLSGGLLWKIPWRLSKFQKRRHRLRLRAVDSVVATLDAALAKKGQTLEAIERWKAEMPVEEEMLPRDKYTMFDRKEKKYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.3
9 0.38
10 0.47
11 0.57
12 0.63
13 0.72
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.88
20 0.89
21 0.9
22 0.84
23 0.8
24 0.7
25 0.61
26 0.5
27 0.41
28 0.3
29 0.19
30 0.13
31 0.07
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.06
40 0.06
41 0.06
42 0.08
43 0.1
44 0.15
45 0.17
46 0.16
47 0.16
48 0.17
49 0.17
50 0.16
51 0.14
52 0.12
53 0.13
54 0.15
55 0.15
56 0.15
57 0.14
58 0.15
59 0.18
60 0.16
61 0.13
62 0.12
63 0.11
64 0.14
65 0.2
66 0.28
67 0.28
68 0.37
69 0.44
70 0.53
71 0.63
72 0.69
73 0.71
74 0.72
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79