Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V4HFP1

Protein Details
Accession A0A4V4HFP1    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
76-103TGSKKSTPASGKKKTSKPKDSPEQTPCRHydrophilic
NLS Segment(s)
PositionSequence
69-94PAKRSRATGSKKSTPASGKKKTSKPK
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MLYWLNNTIVTPPKLELPVWKIFYRVLFEKYYSTWWPVAPEAGPSNAGGQDDDNDEEEEDDERPTPEPPAKRSRATGSKKSTPASGKKKTSKPKDSPEQTPCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.27
4 0.26
5 0.33
6 0.35
7 0.34
8 0.32
9 0.32
10 0.33
11 0.33
12 0.3
13 0.26
14 0.24
15 0.24
16 0.25
17 0.25
18 0.27
19 0.23
20 0.23
21 0.21
22 0.19
23 0.2
24 0.18
25 0.18
26 0.14
27 0.15
28 0.13
29 0.12
30 0.12
31 0.1
32 0.11
33 0.1
34 0.1
35 0.08
36 0.07
37 0.07
38 0.08
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.08
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.11
53 0.15
54 0.19
55 0.24
56 0.33
57 0.37
58 0.39
59 0.43
60 0.48
61 0.54
62 0.58
63 0.61
64 0.6
65 0.64
66 0.66
67 0.63
68 0.62
69 0.59
70 0.61
71 0.62
72 0.63
73 0.65
74 0.7
75 0.78
76 0.82
77 0.85
78 0.86
79 0.86
80 0.86
81 0.88
82 0.86
83 0.86