Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8M749

Protein Details
Accession A0A4S8M749    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MDDLKGGPKKRKISREKAFGIBasic
NLS Segment(s)
PositionSequence
7-15GPKKRKISR
Subcellular Location(s) mito 17, cyto 8
Family & Domain DBs
Amino Acid Sequences MDDLKGGPKKRKISREKAFGIAFPGVPYKALTFTKAYRTYELGRQNRIIYKQFMEADREEAGLWSGFVKHVTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.79
4 0.76
5 0.68
6 0.58
7 0.51
8 0.41
9 0.32
10 0.23
11 0.2
12 0.13
13 0.13
14 0.13
15 0.1
16 0.12
17 0.12
18 0.14
19 0.15
20 0.16
21 0.23
22 0.27
23 0.27
24 0.25
25 0.28
26 0.28
27 0.32
28 0.4
29 0.37
30 0.36
31 0.37
32 0.38
33 0.39
34 0.41
35 0.38
36 0.31
37 0.29
38 0.31
39 0.32
40 0.31
41 0.31
42 0.28
43 0.28
44 0.25
45 0.24
46 0.19
47 0.16
48 0.15
49 0.11
50 0.1
51 0.08
52 0.08
53 0.09