Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8M044

Protein Details
Accession A0A4S8M044    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-74GFVIYFRKRIRRKRRDRALLAAGHydrophilic
NLS Segment(s)
PositionSequence
58-71RKRIRRKRRDRALL
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDLQGTESPTPVFPFRAVSSSEAASLHGQKAKTPIIAGSICGGVMGLAWIIGFVIYFRKRIRRKRRDRALLAAGKLPTEKNKDPEEKIVIPPDPAVLMGHPPGKLPEDESRTSNVSPIPAEHSSPHTSNSLVAPTRELT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.22
4 0.23
5 0.22
6 0.23
7 0.22
8 0.22
9 0.18
10 0.18
11 0.18
12 0.19
13 0.19
14 0.2
15 0.19
16 0.2
17 0.25
18 0.25
19 0.23
20 0.21
21 0.18
22 0.2
23 0.2
24 0.18
25 0.15
26 0.13
27 0.11
28 0.11
29 0.1
30 0.05
31 0.04
32 0.04
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.08
42 0.09
43 0.12
44 0.14
45 0.24
46 0.32
47 0.43
48 0.55
49 0.61
50 0.71
51 0.79
52 0.88
53 0.89
54 0.85
55 0.81
56 0.78
57 0.71
58 0.61
59 0.53
60 0.42
61 0.32
62 0.28
63 0.22
64 0.18
65 0.21
66 0.22
67 0.24
68 0.3
69 0.35
70 0.36
71 0.4
72 0.42
73 0.37
74 0.37
75 0.36
76 0.31
77 0.27
78 0.25
79 0.2
80 0.14
81 0.12
82 0.1
83 0.07
84 0.08
85 0.1
86 0.12
87 0.11
88 0.12
89 0.13
90 0.15
91 0.15
92 0.17
93 0.23
94 0.27
95 0.29
96 0.3
97 0.32
98 0.33
99 0.33
100 0.31
101 0.24
102 0.2
103 0.19
104 0.19
105 0.21
106 0.2
107 0.22
108 0.22
109 0.26
110 0.29
111 0.3
112 0.31
113 0.26
114 0.25
115 0.25
116 0.25
117 0.27
118 0.24
119 0.23