Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KRD6

Protein Details
Accession A0A4S8KRD6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-40DTDNEKPVKSSRKSRRRRHRKAPEHDPDDSGBasic
NLS Segment(s)
PositionSequence
16-31PVKSSRKSRRRRHRKA
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences MKAIIEAEQDTDNEKPVKSSRKSRRRRHRKAPEHDPDDSGGQFSDGDSELIFRELQSDIKQNLMALPDSVSPRIKEGLVAAHRKLSDYYTKFDESPFYLWASLLDPRISFIGLKQDYKDDEELLSSLNKSKEDLHDYYTRYYANAVPQQTSIELSSTSTNLNSLSGSPQKRSFTTRYKKARVSGVRNHMCSLMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.26
4 0.36
5 0.4
6 0.51
7 0.57
8 0.66
9 0.77
10 0.84
11 0.89
12 0.9
13 0.94
14 0.95
15 0.95
16 0.95
17 0.95
18 0.95
19 0.94
20 0.89
21 0.8
22 0.71
23 0.61
24 0.53
25 0.43
26 0.32
27 0.21
28 0.15
29 0.13
30 0.1
31 0.1
32 0.08
33 0.08
34 0.07
35 0.08
36 0.08
37 0.09
38 0.09
39 0.06
40 0.08
41 0.08
42 0.1
43 0.12
44 0.16
45 0.16
46 0.17
47 0.18
48 0.16
49 0.17
50 0.16
51 0.14
52 0.09
53 0.1
54 0.11
55 0.12
56 0.14
57 0.14
58 0.13
59 0.15
60 0.15
61 0.14
62 0.12
63 0.11
64 0.16
65 0.2
66 0.23
67 0.22
68 0.23
69 0.24
70 0.24
71 0.24
72 0.19
73 0.22
74 0.21
75 0.23
76 0.24
77 0.25
78 0.25
79 0.25
80 0.24
81 0.18
82 0.17
83 0.15
84 0.12
85 0.11
86 0.11
87 0.11
88 0.1
89 0.1
90 0.1
91 0.09
92 0.08
93 0.09
94 0.09
95 0.09
96 0.08
97 0.07
98 0.15
99 0.16
100 0.17
101 0.17
102 0.19
103 0.2
104 0.23
105 0.23
106 0.15
107 0.13
108 0.13
109 0.12
110 0.11
111 0.1
112 0.08
113 0.11
114 0.12
115 0.12
116 0.13
117 0.15
118 0.19
119 0.25
120 0.26
121 0.27
122 0.31
123 0.33
124 0.33
125 0.33
126 0.28
127 0.22
128 0.22
129 0.2
130 0.21
131 0.25
132 0.24
133 0.24
134 0.24
135 0.25
136 0.24
137 0.23
138 0.16
139 0.12
140 0.11
141 0.11
142 0.12
143 0.12
144 0.12
145 0.1
146 0.11
147 0.1
148 0.1
149 0.09
150 0.09
151 0.14
152 0.21
153 0.24
154 0.28
155 0.33
156 0.36
157 0.39
158 0.44
159 0.46
160 0.49
161 0.57
162 0.63
163 0.68
164 0.73
165 0.77
166 0.76
167 0.79
168 0.78
169 0.76
170 0.76
171 0.77
172 0.77
173 0.72
174 0.68