Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LI97

Protein Details
Accession A0A4S8LI97   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-38TGSRSCDNTCHRRKRESQKDKKGTKEIAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MMGREVAYRLTGSRSCDNTCHRRKRESQKDKKGTKEIAYEQYLDSNQGVLRGVLHPRKMALPLRHTTVLDKEVAFTSITKRGVCGKGGSPGFEPGTVSWRSTLETGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.39
4 0.46
5 0.52
6 0.6
7 0.65
8 0.64
9 0.68
10 0.76
11 0.81
12 0.84
13 0.85
14 0.86
15 0.86
16 0.91
17 0.89
18 0.87
19 0.83
20 0.77
21 0.69
22 0.65
23 0.58
24 0.54
25 0.49
26 0.42
27 0.35
28 0.32
29 0.28
30 0.22
31 0.17
32 0.11
33 0.09
34 0.09
35 0.09
36 0.06
37 0.07
38 0.07
39 0.12
40 0.14
41 0.15
42 0.14
43 0.15
44 0.16
45 0.19
46 0.23
47 0.24
48 0.27
49 0.28
50 0.32
51 0.33
52 0.33
53 0.31
54 0.28
55 0.25
56 0.2
57 0.18
58 0.15
59 0.14
60 0.15
61 0.13
62 0.11
63 0.12
64 0.17
65 0.19
66 0.18
67 0.18
68 0.24
69 0.26
70 0.28
71 0.28
72 0.24
73 0.3
74 0.31
75 0.32
76 0.27
77 0.29
78 0.28
79 0.26
80 0.25
81 0.17
82 0.21
83 0.2
84 0.2
85 0.17
86 0.17
87 0.19