Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LU09

Protein Details
Accession A0A4S8LU09    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-46VVKQRPGRNRQQLRSRRRGVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 5, vacu 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIAVIVIVAILALLLVVTVVIVVMAIVVKQRPGRNRQQLRSRRRGVTGKAVAMVAVAFVATLSVPVPVPVLPPSKLVTSLSLIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.01
2 0.01
3 0.01
4 0.01
5 0.01
6 0.01
7 0.01
8 0.02
9 0.01
10 0.02
11 0.02
12 0.02
13 0.03
14 0.04
15 0.06
16 0.1
17 0.15
18 0.21
19 0.27
20 0.37
21 0.48
22 0.56
23 0.62
24 0.69
25 0.75
26 0.78
27 0.82
28 0.78
29 0.69
30 0.66
31 0.64
32 0.56
33 0.56
34 0.5
35 0.41
36 0.36
37 0.33
38 0.27
39 0.22
40 0.18
41 0.08
42 0.04
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.07
56 0.11
57 0.14
58 0.15
59 0.17
60 0.2
61 0.2
62 0.22
63 0.22
64 0.21