Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MD68

Protein Details
Accession A0A4S8MD68   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
44-74IHTRRTSCQKPNKSSMNRKYQKKWSNDFMKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 5.5, mito 3, golg 3
Family & Domain DBs
Amino Acid Sequences MDQVEFLWNTFFKTIGNERPETTPPSLTSSPTNSNLRIPLLSYIHTRRTSCQKPNKSSMNRKYQKKWSNDFMKDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.32
4 0.32
5 0.33
6 0.37
7 0.39
8 0.38
9 0.35
10 0.29
11 0.25
12 0.3
13 0.29
14 0.27
15 0.27
16 0.27
17 0.28
18 0.31
19 0.32
20 0.26
21 0.26
22 0.26
23 0.24
24 0.2
25 0.16
26 0.14
27 0.13
28 0.13
29 0.16
30 0.18
31 0.23
32 0.27
33 0.27
34 0.28
35 0.37
36 0.43
37 0.49
38 0.57
39 0.6
40 0.65
41 0.72
42 0.79
43 0.79
44 0.82
45 0.82
46 0.83
47 0.82
48 0.83
49 0.84
50 0.84
51 0.83
52 0.82
53 0.8
54 0.79
55 0.81