Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MYN1

Protein Details
Accession A0A4S8MYN1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-122PLDLRPKRTRAIRRRLTKHEKSLKTLKQRKKDQNFPIRKYAVHydrophilic
NLS Segment(s)
PositionSequence
85-113RPKRTRAIRRRLTKHEKSLKTLKQRKKDQ
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLNKQLLELKNELLQLRVQKIAGGSASKLTKINTVRKSIARVMTVMNQKARQNLREYYKDKKYLPLDLRPKRTRAIRRRLTKHEKSLKTLKQRKKDQNFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.51
4 0.57
5 0.54
6 0.51
7 0.5
8 0.55
9 0.53
10 0.5
11 0.45
12 0.36
13 0.33
14 0.32
15 0.29
16 0.21
17 0.2
18 0.2
19 0.21
20 0.21
21 0.18
22 0.17
23 0.17
24 0.17
25 0.15
26 0.12
27 0.1
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.26
47 0.28
48 0.26
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.28
55 0.28
56 0.31
57 0.35
58 0.4
59 0.43
60 0.44
61 0.49
62 0.52
63 0.49
64 0.51
65 0.48
66 0.48
67 0.5
68 0.52
69 0.56
70 0.58
71 0.67
72 0.63
73 0.64
74 0.6
75 0.65
76 0.66
77 0.66
78 0.69
79 0.69
80 0.75
81 0.81
82 0.86
83 0.87
84 0.86
85 0.86
86 0.86
87 0.81
88 0.77
89 0.79
90 0.77
91 0.78
92 0.79
93 0.78
94 0.78
95 0.84
96 0.87
97 0.88
98 0.89
99 0.89
100 0.9
101 0.91
102 0.86
103 0.86
104 0.79