Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KPP2

Protein Details
Accession A0A4S8KPP2    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SVERDFKSKSKERAVRQYKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, cyto 7.5, cyto_nucl 7, nucl 5.5, pero 2, plas 1, extr 1, E.R. 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR010989  SNARE  
IPR045242  Syntaxin  
IPR006011  Syntaxin_N  
IPR000727  T_SNARE_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF05739  SNARE  
PF00804  Syntaxin  
PROSITE View protein in PROSITE  
PS50192  T_SNARE  
CDD cd15849  SNARE_Sso1  
Amino Acid Sequences QSVERDFKSKSKERAVRQYKIVKPDATPEEIREVTSGDLGTGTIFAEATLASSNRYAETRSAYREVQERQEELKKIERTLAELAQLYQDMSILIQQQDEAIVSIENTASDVEKTVEKGLEHTENAVDHARRARRLRMIFFWICVVIILIIGLAVGLSIGLKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.77
4 0.77
5 0.79
6 0.74
7 0.73
8 0.7
9 0.61
10 0.54
11 0.55
12 0.51
13 0.46
14 0.42
15 0.36
16 0.36
17 0.34
18 0.34
19 0.26
20 0.22
21 0.17
22 0.17
23 0.15
24 0.08
25 0.08
26 0.07
27 0.07
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.06
39 0.07
40 0.08
41 0.08
42 0.09
43 0.1
44 0.1
45 0.15
46 0.17
47 0.2
48 0.23
49 0.22
50 0.24
51 0.28
52 0.29
53 0.3
54 0.3
55 0.28
56 0.28
57 0.33
58 0.33
59 0.3
60 0.36
61 0.31
62 0.29
63 0.3
64 0.26
65 0.24
66 0.25
67 0.23
68 0.16
69 0.15
70 0.15
71 0.12
72 0.12
73 0.08
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.06
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.04
95 0.05
96 0.05
97 0.06
98 0.07
99 0.07
100 0.09
101 0.1
102 0.11
103 0.11
104 0.12
105 0.16
106 0.18
107 0.17
108 0.17
109 0.17
110 0.15
111 0.18
112 0.21
113 0.17
114 0.16
115 0.23
116 0.27
117 0.33
118 0.37
119 0.42
120 0.46
121 0.52
122 0.56
123 0.54
124 0.58
125 0.52
126 0.49
127 0.44
128 0.35
129 0.29
130 0.23
131 0.18
132 0.09
133 0.08
134 0.06
135 0.04
136 0.04
137 0.03
138 0.03
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02