Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8L2H8

Protein Details
Accession A0A4S8L2H8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
26-49SLFLNRRPQRRSRNLQRHRRGNEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MTRIISSFFPVSVSMLTASTTSDPFSLFLNRRPQRRSRNLQRHRRGNEFLFSVRRFFILTPFIKGRNPPTHFAYHVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.1
13 0.15
14 0.16
15 0.21
16 0.31
17 0.35
18 0.41
19 0.45
20 0.52
21 0.57
22 0.65
23 0.7
24 0.7
25 0.77
26 0.81
27 0.88
28 0.89
29 0.88
30 0.84
31 0.8
32 0.73
33 0.65
34 0.58
35 0.5
36 0.43
37 0.4
38 0.35
39 0.31
40 0.26
41 0.24
42 0.21
43 0.19
44 0.19
45 0.21
46 0.21
47 0.26
48 0.28
49 0.3
50 0.32
51 0.35
52 0.4
53 0.43
54 0.46
55 0.44
56 0.47
57 0.5