Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8L688

Protein Details
Accession A0A4S8L688    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
92-115IILILQRRYKNKRVRVKNEFVSISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSNRCYHYSYPLVTTNSSTPPSTQLEPGMMITREYVVDKEDLEAPASVIKAAIESDFELSEGKVDRTAVPKKARKVLGLQATVHPVLAAGWIILILQRRYKNKRVRVKNEFVSISGDTWGEGGMVETQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.32
4 0.32
5 0.28
6 0.23
7 0.25
8 0.28
9 0.27
10 0.26
11 0.23
12 0.21
13 0.21
14 0.22
15 0.21
16 0.17
17 0.15
18 0.14
19 0.13
20 0.12
21 0.12
22 0.11
23 0.09
24 0.09
25 0.09
26 0.1
27 0.12
28 0.12
29 0.12
30 0.11
31 0.1
32 0.11
33 0.1
34 0.09
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.05
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.06
51 0.07
52 0.08
53 0.14
54 0.18
55 0.23
56 0.31
57 0.36
58 0.39
59 0.46
60 0.47
61 0.43
62 0.44
63 0.44
64 0.43
65 0.41
66 0.38
67 0.33
68 0.33
69 0.31
70 0.27
71 0.19
72 0.11
73 0.09
74 0.08
75 0.06
76 0.03
77 0.03
78 0.03
79 0.03
80 0.05
81 0.08
82 0.09
83 0.15
84 0.21
85 0.3
86 0.37
87 0.47
88 0.55
89 0.62
90 0.72
91 0.77
92 0.82
93 0.84
94 0.86
95 0.84
96 0.81
97 0.73
98 0.63
99 0.57
100 0.47
101 0.38
102 0.3
103 0.22
104 0.15
105 0.13
106 0.12
107 0.08
108 0.06