Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V4HFT7

Protein Details
Accession A0A4V4HFT7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-46MEHLAQPDQPNKKKRRRQALSCTECKRRKIKCDRKQPCSPCTRRHydrophilic
NLS Segment(s)
PositionSequence
14-18KKKRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MGMEHLAQPDQPNKKKRRRQALSCTECKRRKIKCDRKQPCSPCTRRGEQAKCQWHVVESV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.75
3 0.81
4 0.85
5 0.84
6 0.86
7 0.88
8 0.89
9 0.86
10 0.86
11 0.82
12 0.81
13 0.76
14 0.72
15 0.69
16 0.64
17 0.66
18 0.69
19 0.74
20 0.74
21 0.8
22 0.83
23 0.83
24 0.87
25 0.83
26 0.8
27 0.8
28 0.76
29 0.74
30 0.72
31 0.69
32 0.67
33 0.71
34 0.7
35 0.69
36 0.73
37 0.73
38 0.69
39 0.67
40 0.59