Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MC55

Protein Details
Accession A0A4S8MC55   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
191-216DESNRDERLKRSRREPKSRSRLVLLRBasic
NLS Segment(s)
PositionSequence
199-211LKRSRREPKSRSR
Subcellular Location(s) nucl 10, mito 9, cyto 5, plas 1, pero 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MPYYQVEPWANPPVTRLGSATGLTSYHSTSSHPSGELCPTTFPSPYPLRMMQLEQQLPSQIPTRFGLDISSNIPARSQLPPPVPPPVPMPLPSQVETEVEVVSYLKPGNIYLDLSESPRVIRTAAQTGLGHPLARYLRVPATNPPLPSLTIEHPKIPWSMTAHRSCLNPHCVTVGDVLLRILETMQTPLIDESNRDERLKRSRREPKSRSRLVLLRGKQMFVGLRKDSNGDVWIMESI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.28
4 0.22
5 0.23
6 0.24
7 0.23
8 0.17
9 0.15
10 0.15
11 0.16
12 0.14
13 0.13
14 0.13
15 0.13
16 0.17
17 0.21
18 0.22
19 0.21
20 0.21
21 0.22
22 0.27
23 0.28
24 0.24
25 0.22
26 0.23
27 0.25
28 0.24
29 0.22
30 0.23
31 0.25
32 0.26
33 0.3
34 0.28
35 0.29
36 0.31
37 0.33
38 0.32
39 0.36
40 0.35
41 0.3
42 0.3
43 0.28
44 0.26
45 0.25
46 0.25
47 0.18
48 0.19
49 0.19
50 0.21
51 0.2
52 0.2
53 0.2
54 0.16
55 0.17
56 0.16
57 0.18
58 0.16
59 0.15
60 0.15
61 0.14
62 0.16
63 0.17
64 0.18
65 0.2
66 0.23
67 0.26
68 0.28
69 0.33
70 0.31
71 0.29
72 0.3
73 0.27
74 0.26
75 0.24
76 0.26
77 0.24
78 0.27
79 0.26
80 0.25
81 0.22
82 0.21
83 0.2
84 0.18
85 0.13
86 0.09
87 0.08
88 0.07
89 0.07
90 0.07
91 0.06
92 0.05
93 0.05
94 0.05
95 0.07
96 0.07
97 0.07
98 0.07
99 0.09
100 0.09
101 0.1
102 0.11
103 0.09
104 0.09
105 0.09
106 0.09
107 0.08
108 0.09
109 0.1
110 0.12
111 0.13
112 0.15
113 0.14
114 0.14
115 0.17
116 0.16
117 0.14
118 0.1
119 0.14
120 0.12
121 0.13
122 0.13
123 0.11
124 0.14
125 0.16
126 0.17
127 0.18
128 0.25
129 0.27
130 0.27
131 0.26
132 0.24
133 0.23
134 0.23
135 0.22
136 0.19
137 0.23
138 0.24
139 0.23
140 0.23
141 0.24
142 0.23
143 0.2
144 0.2
145 0.18
146 0.23
147 0.3
148 0.33
149 0.34
150 0.36
151 0.36
152 0.36
153 0.37
154 0.38
155 0.32
156 0.29
157 0.27
158 0.25
159 0.25
160 0.23
161 0.18
162 0.12
163 0.11
164 0.1
165 0.09
166 0.08
167 0.07
168 0.06
169 0.05
170 0.05
171 0.07
172 0.07
173 0.07
174 0.08
175 0.09
176 0.11
177 0.1
178 0.11
179 0.15
180 0.22
181 0.25
182 0.26
183 0.27
184 0.32
185 0.43
186 0.52
187 0.52
188 0.56
189 0.64
190 0.73
191 0.82
192 0.85
193 0.85
194 0.87
195 0.89
196 0.83
197 0.8
198 0.76
199 0.72
200 0.73
201 0.66
202 0.65
203 0.58
204 0.53
205 0.46
206 0.43
207 0.41
208 0.36
209 0.39
210 0.33
211 0.34
212 0.34
213 0.36
214 0.34
215 0.31
216 0.28
217 0.22
218 0.18