Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8M5E8

Protein Details
Accession A0A4S8M5E8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-110LQVVQSRENRRRRPGKPSRMKVKSCKSHydrophilic
NLS Segment(s)
PositionSequence
55-106SEKKKKQKANGRGEEAKSERKEGKKRVKELQVVQSRENRRRRPGKPSRMKVK
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MPQPILVRAVINYAAMNRKLSAQGPSVRPAQEREVEEKARWVEKEASEKKLQEDSEKKKKQKANGRGEEAKSERKEGKKRVKELQVVQSRENRRRRPGKPSRMKVKSCKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.21
4 0.18
5 0.2
6 0.21
7 0.23
8 0.23
9 0.23
10 0.28
11 0.29
12 0.32
13 0.34
14 0.34
15 0.33
16 0.33
17 0.32
18 0.31
19 0.31
20 0.33
21 0.35
22 0.35
23 0.34
24 0.35
25 0.32
26 0.3
27 0.27
28 0.25
29 0.24
30 0.25
31 0.35
32 0.34
33 0.37
34 0.37
35 0.37
36 0.36
37 0.36
38 0.33
39 0.3
40 0.36
41 0.39
42 0.48
43 0.55
44 0.56
45 0.59
46 0.62
47 0.64
48 0.66
49 0.68
50 0.68
51 0.68
52 0.72
53 0.71
54 0.68
55 0.66
56 0.59
57 0.56
58 0.46
59 0.42
60 0.41
61 0.43
62 0.5
63 0.54
64 0.62
65 0.63
66 0.68
67 0.73
68 0.75
69 0.75
70 0.73
71 0.73
72 0.71
73 0.66
74 0.64
75 0.63
76 0.63
77 0.65
78 0.68
79 0.66
80 0.67
81 0.74
82 0.76
83 0.79
84 0.81
85 0.83
86 0.85
87 0.88
88 0.88
89 0.88
90 0.91