Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8M3N8

Protein Details
Accession A0A4S8M3N8    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21CCDIVKKPKLDQHRNRCHAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039999  LYAR  
IPR014898  Znf_C2H2_LYAR  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08790  zf-LYAR  
Amino Acid Sequences ACCDIVKKPKLDQHRNRCHAGFDCIDCSKSFGTPAEYKGHTSCISEAEKYQKSLYKGPKVRFGWFSFLFFFFSFFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.79
4 0.72
5 0.66
6 0.58
7 0.52
8 0.44
9 0.35
10 0.34
11 0.29
12 0.29
13 0.25
14 0.23
15 0.18
16 0.15
17 0.15
18 0.11
19 0.15
20 0.16
21 0.19
22 0.21
23 0.21
24 0.22
25 0.21
26 0.23
27 0.19
28 0.18
29 0.16
30 0.16
31 0.17
32 0.16
33 0.17
34 0.22
35 0.23
36 0.24
37 0.26
38 0.26
39 0.28
40 0.35
41 0.42
42 0.45
43 0.51
44 0.53
45 0.6
46 0.59
47 0.61
48 0.59
49 0.54
50 0.51
51 0.46
52 0.45
53 0.38
54 0.36
55 0.34
56 0.28