Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LEJ2

Protein Details
Accession A0A4S8LEJ2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
78-104SRECHWFSKTEKRRRNRKKSSTGIGFEHydrophilic
NLS Segment(s)
PositionSequence
89-96KRRRNRKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.833, cyto_mito 5.833, mito 5.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MELLVLKDLQRQDRHRVIWEVLHTAAQACEDELSANNTVKLSLTGWVHVSSDQNEHYTLRSYDASGSLVGSIHMGAESRECHWFSKTEKRRRNRKKSSTGIGFEPHRHVYIGEAFTQELEIHSDEIRSPKTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.55
4 0.5
5 0.47
6 0.45
7 0.39
8 0.32
9 0.29
10 0.24
11 0.2
12 0.18
13 0.13
14 0.1
15 0.07
16 0.07
17 0.06
18 0.07
19 0.07
20 0.1
21 0.11
22 0.12
23 0.12
24 0.12
25 0.12
26 0.11
27 0.11
28 0.09
29 0.1
30 0.1
31 0.11
32 0.12
33 0.13
34 0.13
35 0.13
36 0.14
37 0.11
38 0.13
39 0.13
40 0.13
41 0.13
42 0.13
43 0.13
44 0.14
45 0.13
46 0.13
47 0.12
48 0.12
49 0.12
50 0.12
51 0.12
52 0.09
53 0.09
54 0.07
55 0.06
56 0.06
57 0.05
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.05
64 0.06
65 0.07
66 0.1
67 0.11
68 0.12
69 0.14
70 0.17
71 0.2
72 0.31
73 0.4
74 0.48
75 0.56
76 0.65
77 0.75
78 0.83
79 0.9
80 0.9
81 0.9
82 0.9
83 0.9
84 0.9
85 0.87
86 0.79
87 0.71
88 0.66
89 0.58
90 0.51
91 0.47
92 0.39
93 0.31
94 0.29
95 0.25
96 0.23
97 0.26
98 0.25
99 0.21
100 0.2
101 0.19
102 0.19
103 0.2
104 0.16
105 0.1
106 0.11
107 0.11
108 0.11
109 0.12
110 0.12
111 0.14
112 0.19