Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LG17

Protein Details
Accession A0A4S8LG17    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-35KESGIMMRKIKRRKNSRLNRRDTMLHydrophilic
NLS Segment(s)
PositionSequence
18-27RKIKRRKNSR
Subcellular Location(s) mito 12.5, cyto_mito 8, nucl 3, plas 3, E.R. 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLLRLFIEMEKESGIMMRKIKRRKNSRLNRRDTMLDYSHTSLVTLLAFGIQLAVANLCDCDVGERVSGRGNASKWYQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.2
4 0.27
5 0.34
6 0.44
7 0.52
8 0.6
9 0.67
10 0.75
11 0.8
12 0.84
13 0.88
14 0.89
15 0.89
16 0.83
17 0.76
18 0.68
19 0.6
20 0.54
21 0.45
22 0.36
23 0.3
24 0.27
25 0.24
26 0.2
27 0.17
28 0.12
29 0.11
30 0.08
31 0.06
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.06
48 0.07
49 0.08
50 0.1
51 0.11
52 0.11
53 0.15
54 0.17
55 0.18
56 0.22
57 0.22
58 0.25