Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LD94

Protein Details
Accession A0A4S8LD94    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-90FLTFIYVKRPRHRRNKNTNSLIPIPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences RVFTASDGAEYKWVLGLTTSELFTNTSPTTPVAKFHRRKLGIFTPKAIRTHLEIYPAGHYIADEIFLTFIYVKRPRHRRNKNTNSLIPIPTSKMPSLLCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.12
5 0.13
6 0.14
7 0.12
8 0.12
9 0.13
10 0.13
11 0.16
12 0.13
13 0.12
14 0.12
15 0.14
16 0.18
17 0.17
18 0.22
19 0.25
20 0.35
21 0.4
22 0.46
23 0.55
24 0.53
25 0.53
26 0.56
27 0.58
28 0.57
29 0.53
30 0.5
31 0.46
32 0.47
33 0.47
34 0.4
35 0.31
36 0.25
37 0.27
38 0.24
39 0.21
40 0.18
41 0.18
42 0.19
43 0.18
44 0.15
45 0.11
46 0.1
47 0.08
48 0.07
49 0.07
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.05
56 0.06
57 0.12
58 0.18
59 0.24
60 0.33
61 0.44
62 0.54
63 0.64
64 0.75
65 0.8
66 0.85
67 0.91
68 0.93
69 0.91
70 0.88
71 0.84
72 0.77
73 0.68
74 0.6
75 0.51
76 0.45
77 0.39
78 0.37
79 0.3
80 0.29