Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8M4I9

Protein Details
Accession A0A4S8M4I9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
217-239LVAFLFCRRRRHQVRKYEEPESFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR044912  Egfr_JX_dom  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSILLILLLWIEGTVHAQRNITVQEVDPLISYNTDVVDWGLPQNNSDSASDPTGDIFALTARSGAVATFTFTGTDVYYFAPLWPMRIFCRLSLDGGADEIADLEDYSVPDSGLQTSDVSKPTGIRWSKTGLENKTHQVLVKVGNWAVVEHFVYTTAPSEDVSSASGQSSTDSSSTDTPRSPSATTSQAGTPASSSTSTIVGGVVGGVLGLVLCGILVAFLFCRRRRHQVRKYEEPESFITISPFVTSNNILTSGTSYTISPTTYSDCKSNLRPPPYTPYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.11
3 0.15
4 0.17
5 0.18
6 0.19
7 0.22
8 0.24
9 0.23
10 0.21
11 0.17
12 0.2
13 0.2
14 0.19
15 0.16
16 0.15
17 0.13
18 0.12
19 0.12
20 0.09
21 0.09
22 0.08
23 0.08
24 0.08
25 0.08
26 0.09
27 0.11
28 0.15
29 0.14
30 0.15
31 0.17
32 0.17
33 0.18
34 0.19
35 0.18
36 0.17
37 0.18
38 0.18
39 0.16
40 0.15
41 0.13
42 0.12
43 0.09
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.05
50 0.06
51 0.06
52 0.06
53 0.07
54 0.06
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09
61 0.08
62 0.08
63 0.08
64 0.08
65 0.09
66 0.09
67 0.08
68 0.12
69 0.12
70 0.14
71 0.14
72 0.15
73 0.16
74 0.22
75 0.23
76 0.18
77 0.25
78 0.23
79 0.23
80 0.23
81 0.21
82 0.16
83 0.15
84 0.14
85 0.08
86 0.07
87 0.05
88 0.04
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.07
102 0.06
103 0.08
104 0.1
105 0.11
106 0.11
107 0.11
108 0.11
109 0.12
110 0.2
111 0.2
112 0.19
113 0.19
114 0.23
115 0.25
116 0.3
117 0.36
118 0.3
119 0.33
120 0.35
121 0.36
122 0.34
123 0.32
124 0.26
125 0.21
126 0.19
127 0.18
128 0.17
129 0.15
130 0.13
131 0.14
132 0.14
133 0.13
134 0.11
135 0.09
136 0.08
137 0.07
138 0.07
139 0.05
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.07
148 0.07
149 0.08
150 0.07
151 0.07
152 0.07
153 0.07
154 0.06
155 0.06
156 0.07
157 0.07
158 0.07
159 0.07
160 0.09
161 0.12
162 0.14
163 0.15
164 0.16
165 0.17
166 0.18
167 0.2
168 0.19
169 0.18
170 0.19
171 0.21
172 0.2
173 0.2
174 0.19
175 0.19
176 0.19
177 0.17
178 0.14
179 0.11
180 0.12
181 0.1
182 0.11
183 0.09
184 0.09
185 0.09
186 0.09
187 0.08
188 0.06
189 0.06
190 0.05
191 0.04
192 0.03
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.01
200 0.01
201 0.01
202 0.01
203 0.02
204 0.02
205 0.02
206 0.03
207 0.08
208 0.15
209 0.19
210 0.28
211 0.33
212 0.44
213 0.54
214 0.65
215 0.7
216 0.75
217 0.8
218 0.83
219 0.85
220 0.81
221 0.72
222 0.65
223 0.58
224 0.53
225 0.45
226 0.34
227 0.29
228 0.22
229 0.21
230 0.18
231 0.15
232 0.11
233 0.13
234 0.13
235 0.13
236 0.14
237 0.15
238 0.14
239 0.14
240 0.16
241 0.14
242 0.14
243 0.14
244 0.12
245 0.14
246 0.15
247 0.15
248 0.14
249 0.15
250 0.19
251 0.22
252 0.25
253 0.26
254 0.28
255 0.33
256 0.4
257 0.47
258 0.51
259 0.54
260 0.55
261 0.57