Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N6G2

Protein Details
Accession G9N6G2    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSSRSSSKKFNNQRKAASIFHydrophilic
80-119KPVRAFSTKKGINKKRKKSSIVFPKYTDRLRKNRNAPKKAHydrophilic
NLS Segment(s)
PositionSequence
80-119KPVRAFSTKKGINKKRKKSSIVFPKYTDRLRKNRNAPKKA
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSSKKFNNQRKAASIFGPAETARQERLSAKLLELAKQAKPEPAEMKIDDESNNAPEKEEQAGADENSMEVDSKKPVRAFSTKKGINKKRKKSSIVFPKYTDRLRKNRNAPKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.8
4 0.74
5 0.66
6 0.57
7 0.52
8 0.42
9 0.35
10 0.31
11 0.24
12 0.21
13 0.2
14 0.2
15 0.16
16 0.15
17 0.16
18 0.16
19 0.2
20 0.22
21 0.2
22 0.19
23 0.23
24 0.23
25 0.23
26 0.25
27 0.24
28 0.21
29 0.23
30 0.24
31 0.21
32 0.21
33 0.23
34 0.22
35 0.21
36 0.23
37 0.21
38 0.23
39 0.21
40 0.21
41 0.18
42 0.16
43 0.15
44 0.13
45 0.15
46 0.12
47 0.12
48 0.11
49 0.12
50 0.12
51 0.12
52 0.1
53 0.1
54 0.11
55 0.11
56 0.11
57 0.09
58 0.07
59 0.07
60 0.07
61 0.06
62 0.05
63 0.06
64 0.1
65 0.12
66 0.16
67 0.17
68 0.18
69 0.23
70 0.32
71 0.37
72 0.41
73 0.5
74 0.51
75 0.57
76 0.67
77 0.72
78 0.74
79 0.79
80 0.82
81 0.83
82 0.86
83 0.87
84 0.83
85 0.84
86 0.84
87 0.83
88 0.78
89 0.71
90 0.7
91 0.69
92 0.7
93 0.69
94 0.67
95 0.67
96 0.72
97 0.78
98 0.8
99 0.84