Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MGZ7

Protein Details
Accession G9MGZ7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
93-131GHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAWBasic
NLS Segment(s)
PositionSequence
100-128KRRHGWLKRTRSKTGRRILQRRKLKGRRH
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNSIIRLARPLLAPRISPLAQRTYTCLSPLRPTLTSTFRPNNSFTPSLTAQSPATAAATSPESADLVPTAAVSSHPALQGLQLRFGPRNTMNGHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.31
4 0.32
5 0.31
6 0.31
7 0.32
8 0.32
9 0.34
10 0.33
11 0.33
12 0.32
13 0.32
14 0.28
15 0.3
16 0.33
17 0.32
18 0.28
19 0.3
20 0.32
21 0.34
22 0.36
23 0.38
24 0.41
25 0.4
26 0.42
27 0.42
28 0.41
29 0.41
30 0.38
31 0.31
32 0.3
33 0.28
34 0.27
35 0.25
36 0.23
37 0.17
38 0.16
39 0.15
40 0.1
41 0.09
42 0.07
43 0.07
44 0.06
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.05
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.04
59 0.05
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.1
66 0.16
67 0.15
68 0.16
69 0.16
70 0.18
71 0.19
72 0.19
73 0.23
74 0.17
75 0.22
76 0.23
77 0.28
78 0.3
79 0.31
80 0.32
81 0.31
82 0.38
83 0.42
84 0.46
85 0.47
86 0.52
87 0.57
88 0.66
89 0.72
90 0.71
91 0.73
92 0.77
93 0.81
94 0.84
95 0.82
96 0.82
97 0.82
98 0.84
99 0.84
100 0.83
101 0.82
102 0.83
103 0.87
104 0.88
105 0.89
106 0.89
107 0.9
108 0.91
109 0.91
110 0.9
111 0.9