Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NDN3

Protein Details
Accession G9NDN3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKSSSRKPMGPKRADPLBasic
NLS Segment(s)
PositionSequence
4-14RKSSSRKPMGP
Subcellular Location(s) mito 18, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSRKPMGPKRADPLPTTFTCLFCNHEKSVTVKLDRRAGVGQLDCRICGQKFQCAVNYLSAAVDVYGEWVDAAEAVAKQDAGEGNASKSYGSRRPLDKTTVDEHDEIDQHDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.76
4 0.7
5 0.62
6 0.57
7 0.52
8 0.44
9 0.45
10 0.4
11 0.34
12 0.33
13 0.32
14 0.3
15 0.28
16 0.33
17 0.27
18 0.28
19 0.28
20 0.28
21 0.33
22 0.34
23 0.35
24 0.34
25 0.37
26 0.41
27 0.4
28 0.4
29 0.33
30 0.29
31 0.28
32 0.25
33 0.23
34 0.21
35 0.21
36 0.18
37 0.18
38 0.19
39 0.16
40 0.19
41 0.18
42 0.19
43 0.21
44 0.22
45 0.24
46 0.23
47 0.24
48 0.21
49 0.2
50 0.14
51 0.12
52 0.11
53 0.08
54 0.06
55 0.05
56 0.03
57 0.04
58 0.04
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.07
74 0.09
75 0.09
76 0.1
77 0.11
78 0.12
79 0.1
80 0.12
81 0.16
82 0.2
83 0.24
84 0.29
85 0.34
86 0.4
87 0.45
88 0.49
89 0.47
90 0.46
91 0.47
92 0.47
93 0.45
94 0.4
95 0.37
96 0.35
97 0.33
98 0.29